RadicalRick

Editorial »

RadicalRick
  Junior Editor

A member of the Definitions.net vibrant community of passionate editors.

  March 2022     2 years ago

Latest Entries: 0 total

There are currently no submitted entries

Latest Comments: 3 total

Definitions.net
You have to give him some leeway. He said he's been teaching for nearly 50 years. He might have a
loss of cognitive functioning — thinking, remembering, and reasoning (Dementia)by now.

2 years ago

View
Definitions.net
I was going to point out some errors on your part. But seeing the comments below, You have already been corrected.
I Feel like I'm watching "Finding Forrester" again.

2 years ago

View
Definitions.net
I still got it. I got a perfect score on my High School SAT back in 82. So It's nice to see that I haven't lost all my marbles yet.

2 years ago

View

Mind helping us out?

We're currently missing definitions for several entries people are searching for.

chudaitante黑丝jelingmized
melnibonean幼女jack hansontobrutradada
biggavelshewedskippidylyricssyroger and arnie

Couldn't find something you know? there's more...

We need you!

Help us build the largest human-edited definitions collection on the web!

Free, no signup required:

Add to Chrome

Get instant definitions for any word that hits you anywhere on the web!

Free, no signup required:

Add to Firefox

Get instant definitions for any word that hits you anywhere on the web!

Browse Definitions.net

Quiz

Are you a words master?

»
a feeling facetious merriment
A jocularity
B imperviousness
C chin-wag
D substrate