Found 1,541 definitions starting with VA:

vava-jay-jayva-va-voomva.
vaadvaagmervaalvaaljapie
vaasavacvacanciesvacancy
vacancy defectvacancy ratevacantvacant lot
vacantlyvacantnessvacatevacated
vacatiavacatingvacationvacation bible scho…
vacation dayvacation homevacation listing se…vacation spot
vacationervacationfuturesvacationingvacationist
vacationlandvacaturvacavillevaccaria
vaccaria hispanicavaccaria pyramidatavaccaryvaccenic
vaccenic acidvaccenylvaccenyl acetatevaccimulgence
vaccinavaccinablevaccinalvaccinate
vaccinatedvaccinatingvaccinationvaccination mark
vaccinationlikevaccinatorvaccinevaccinee
vaccinesvaccines, acellularvaccines, attenuatedvaccines, combined
vaccines, conjugatevaccines, contracep…vaccines, dnavaccines, edible
vaccines, inactivat…vaccines, markervaccines, subunitvaccines, synthetic
vaccines, virosomevacciniavaccinia gangrenosavaccinia virus
vaccinistvacciniumvaccinium angustifo…vaccinium arboreum
vaccinium asheivaccinium caespitos…vaccinium corymbosumvaccinium macrocarp…
vaccinium myrsinitesvaccinium myrtillusvaccinium ovatumvaccinium oxycoccus
vaccinium pallidumvaccinium parvifoli…vaccinium pennsylva…vaccinium scoparium
vaccinium stamineumvaccinium uliginosu…vaccinium virgatumvaccinium vitis-ida…
vaccinogenvaccinologistvaccinologyvaccinum
vaccsysvachel lindsayvachelliavachellia farnesiana
vachervacherievacherinvachery
vacillancyvacillantvacillatevacillated
vacillatingvacillatinglyvacillationvacillator
vacillatoryvacivityvaclavvaclav havel
vacuavacuatevacuationvacuist
vacuityvacunavacuolarvacuolar proton-tra…
vacuolatevacuolatedvacuolationvacuole
vacuolesvacuolicvacuolinvacuolisation
vacuolizationvacuousvacuouslyvacuousness
vacutainervacuumvacuum aspirationvacuum bag
vacuum bombvacuum bottlevacuum chambervacuum cleaner
vacuum curettagevacuum decayvacuum desiccatorvacuum distillation
vacuum energyvacuum extraction, …vacuum flaskvacuum fluorescent …
vacuum formingvacuum gagevacuum gaugevacuum pump
vacuum tubevacuum, absolutevacuum, highvacuum, low
vacuum, partialvacuum, torricellianvacuum-cleanvacuum-packed
vacuumablevacuumlikevacuumsvada
vada pavvadantesvaddingvaddio
vadevade mecumvadervadge
vadivadiavadimonyvadio
vadiumvadovadodaravadose
vadouvanvads\u00f8vadsøvaduz
vadvervaevaesitevafrous
vaf\u00fer\u00fa\u0…vagvagabondvagabondage
vagabondingvagabondishvagabondismvagabondize
vagabondryvagabondsvagalvagally
vagancyvagantesvágarvagaries
vagariousvagarityvagarosavagary
vagationvågevagientvagile
vagilityvaginavagina dentatavagina envy
vagina tendinisvaginaevaginalvaginal artery
vaginal birthvaginal birth after…vaginal condomvaginal creams, foa…
vaginal dischargevaginal diseasesvaginal douchingvaginal fistula
vaginal flatulencevaginal fluidvaginal neoplasmsvaginal ring
vaginal sexvaginal smearvaginal smearsvaginaless
vaginalikevaginalitisvaginallyvaginant
vaginasvaginatevaginatedvaginati
vaginatoidvaginectomyvaginervosevaginicola
vaginismusvaginitisvaginocelevaginopennous
vaginoplastyvaginosisvaginosis, bacterialvaginula
vaginulevagin\u00e6vagissatevagitus
vagitus uterinusvagliavagn walfrid ekmanvago-
vagotomyvagotomy, proximal …vagotomy, truncalvagotonia
vagousvagrancyvagrantvagrantly
vagrantnessvaguevagueishvaguely
vaguenessvagueryvaguishvagus
vagus nervevagus nerve diseasesvagus nerve stimula…váh
vahagnvahanavahovai
vai peoplevaidadevaievaigatz
vailvailervaillantvaillante
vaimurevainväinämöinenvainglorious
vaingloriouslyvaingloriousnessvaingloryvainilla
vainlyvainnessvairvairagya
vairyvaisakhavaisakhivaishak
vaisheshikavaishnavavaishnavasvaishnavism
vaishyavaisnavaravaisnavismvaisya
vaisyasvaivodevajazzlevajdakite
vajpayeevajravajrayanavåk
vakavakeelvakilval
val badiaval.valavalaciclovir
valaisvalancevalance boardvalanced
valancelikevalancingvalandovovalant medical solu…
valarivalarievalchemyvalda
valdai hillsvaldecoxibvaldezvaldivia
valdostavalevale of tearsvale of tempe
valedictionvaledictorianvaledictoriesvaledictory
valedictory addressvaledictory speakervalen technologiesvalence
valence bandvalence bondvalence electronvalence health
valence isomervalence issuevalence shellvalence technology
valencellvalencenevalenciavalencia orange
valencianvalencian communityvalenciennesvalenciennes lace
valenciesvalencyvalenkivalens
valens, flaviusvalentvalentivalentia
valentinvalentinavalentina tereshkovavalentina vladmirov…
valentinevalentine dayvalentine's dayvalentine, basil
valentinelessvalentines dayvalentinianvalentinian i
valentinian i.valentiniansvalentinitevalentino
valentino pascuccivalentinusvalenzavaleo medical
vålervaleravaleralvaleraldehyde
valeramidevaleratevaleratesvalerene
valeriavaleria messalinavalerianvalerian family
valerianavaleriana officinal…valerianaceaevalerianaceous
valerianatevalerianellavalerianella locustavalerianella olitor…
valerianicvalerianus, luciniusvalericvaleric acid
valeridinevalerievalerie carrvalerin
valerion therapeuti…valeritasvaleritrinevalerius
valerius maximusvalerovalero-valerol
valeronevalerophenonevaléryvaleryl
valerylenevaletvalet de chambrevalet parking
valet-de-chambrevaletevalettavalette, cantal
valette, jean paris…valetudinarianvaletudinarianismvaletudinary
valetudinousvalga, estoniavalganciclovirvalgus
valhallavalivaliancevaliancy
valiantvaliant healthvaliantlyvaliantness
validvalid claimvalidasvalidatable
validatevalidatedvalidatingvalidation
validation studiesvalidation studies …validation therapyvalidator
validatoryvalidifyvalidityvalidly
validnessvalidus dc systems,…valientevaliha
valinchvalinevaline dehydrogenas…valine-trna ligase
valinesvalinomycinvalisvalise
valiselikevaliumvalknutvalkyr
valkyriavalkyrianvalkyrievalkyrie computer s…
valkyrielikevalkyrsvallavalla, laurence
valladolidvallaivallancyvallar
vallaryvallatavallationvallatory
vallaurisvalle d'aostavalle daostavalle, norway
valleculavalleculaevallecularvallegrande
vallejovallenarvallenatovalleriite
valleryvallèsvalles marinerisvallet's pills
vallettavalleyvalley boyvalley fever
valley fillvalley forgevalley girlvalley miwok
valley oakvalley of deathvalley of ten thous…valley of the kings
valley of the shado…valley pocket gophervalley rivervalley white oak
valleyfieldvalleysvalleyspeakvalleytronics
valleywardvalleywardsvalliantvallis
vallisneriavallisneria america…vallisneria spiralisvallombrosa
vallombrosa abbeyvallonvallumvallums
valmarcvalmikivalmyvalnemulin
valofanevaloisvalonavalonia
valorvaloresvalorisationvalorize
valorousvalorouslyvalorousnessvalour
valparaisovalpara\u00edsovalpovalpolicella
valproatevalproicvalproic acidvalpromide
valrubicinvalsvalsalva maneuvervalsalvian
valsartanvalsevalspeakvaltronic
valuablevaluable cargovaluablenessvaluables
valuablyvaluatevaluationvaluation account
valuation functionvaluation reservevaluativevaluator
valuevalue addedvalue added taxvalue at risk
value betvalue chainvalue datevalue domain
value drivenvalue for moneyvalue investingvalue judgement
value judgmentvalue of lifevalue orientationvalue over replacem…
value propositionvalue raisevalue statementvalue system
value theoryvalue typevalue votervalue-add
value-addedvalue-added networkvalue-added resellervalue-added tax
value-systemvalueappealvalueclickvalued
valuelessvaluelesslyvaluelessnessvalueness
valuervaluesvalues of nvaluing
valunetvalurevalvavalvai
valvasorvalvatavalvatevalve
valve oilvalve rockervalve trainvalve, electrically…
valve-in-head enginevalve-shellvalvedvalveless
valveletvalvelikevalverde provincevalvetrain
valvettithuraivalvexchangevalvoplastyvalvotomy
valvulavalvulaevalvularvalvular heart dise…
valvular incompeten…valvulevalvulitisvalvulopathy
valvuloplastyvalvulotomyvalylvalylene
valzinvambasiumvambéry, arminiusvambrace
vamovamoosevamoose busvamos
vamosevampvamp communicationsvamp up
vampedvampervampilyvampiness
vampingvampirevampire batvampiredom
vampirelikevampiresvampiresquevampiress
vampirettevampireyvampiricvampirical
vampiricallyvampirisationvampirisevampirish
vampirismvampiristvampirizationvampirize
vampirovampirologicalvampirologistvampirology
vampishvampishlyvampishnessvamplate
vampsvampyvampyrvamure
vanvan allenvan allen beltvan allen radiation…
van beethovenvan bogaert encepha…van burenvan buren, martin
van de graaffvan de graaff gener…van de veldevan der hum
van der waal's forc…van der waalsvan der waals forcevan der waals' forc…
van diemen's landvan diemens landvan dorenvan dyck
van eyckvan gilder insurancevan god losvan gogh
van rensselaervan vleckvan wyck brooksvan't hoff
van-couriervanadvanadatevanadates
vanadatianvanadiavanadianvanadiate
vanadicvanadic acidvanadiferousvanadinite
vanadiocarpholitevanadiousvanaditevanadium
vanadium bromoperox…vanadium chromagenvanadium compoundsvanadium pentoxide
vanadium steelvanadium-50vanadium-51vanadium-associated…
vanadiumdravitevanadoanvanadocytevanadomalayaite
vanadousvanadous acidvanadylvanadyl acetylaceto…
vanadylianvanalitevanaspativanbrugh
vanbrugh, sir johnvancevancian magicvancocin
vancomycinvancomycin resistan…vancouvervancouver island
vancouver island ma…vancouveritevandavanda coerulea
vandalvandalia researchvandalicvandalic language
vandalisationvandalisevandalisedvandalism
vandalisticvandalizationvandalizevandalized
vandalousvandalsvandenbergvandenberg catalyst
vandenbrandeitevandendriesscheitevanderbiltvanderbilt, corneli…
vandeveldt, williamvandorenvandré sagrilo mon…vandyck, sir anthony
vandykevandyke beardvandyke brownvandyke collar
vandyne superturbovanevane, sir henryvaned
vanellusvanernvanessavanessa atalanta
vanessa bellvanessa stephenvanessa virginiensisvanessian
vanettevanfessvanfulvang
vang, opplandvangavangard voice syste…vangaži
vangelovanglovangogh imagingvanguard
vanguardiavanguardismvanguardistvanguards of conque…
vangueriavangueria infaustavangueria madagasca…vani
vaniervanillavanilla beanvanilla extract
vanilla ice creamvanilla orchidvanilla planifoliavanilla pudding
vanilla sexvanilla slicevanillatevanillekipferl
vanillicvanillic acidvanillinvanilloes
vanilloidvanillylvanillyl groupvaniloquence
vaniloquentvanirvanishvanished
vanishervanishingvanishing creamvanishing point
vanishinglyvanishmentvanitasvanities
vanitizevanityvanity casevanity domain
vanity fairvanity license platevanity numbervanity plate
vanity pressvanity publishervanity publishingvanity table
vanjasvanlikevanloadvanmeersscheite
vannevannervanner hawkvannes
vannevarvannevar bushvanningvano language
vanoxerinevanoxitevanpoolvanquish
vanquish oncologyvanquishablevanquishedvanquisher
vanquishingvanquishmentvansirevant
vant-couriervantaavantagevantage hospice
vantage mediavantage pointvantageilmvantasselite
vantbracevantbrassvanthoffitevantos
vanuvanuavanua levuvanuatu
vanuatuanvanuralitevanwardvanya
vanzettivapvapaliximabvaphio
vapidvapidityvapidlyvapidness
vaporvapor bathvapor densityvapor globe
vapor lockvapor pressurevapor retardervapor trail
vaporabilityvaporablevaporatevaporation
vaporevaporedvaporervaporiferous
vaporificvaporiformvaporimetervaporing
vaporisationvaporisevaporisedvaporish
vaporizablevaporizationvaporizevaporized
vaporizervaporizingvaporlikevaporose
vaporousvaporousnessvaporsvaporware
vaporwirevaporyvapothermvapour
vapour bathvapour densityvapour lockvapour pressure
vapour trailvapourervapourettevapourish
vapoursvapourwarevapouryvappodes
vappodes phalaenops…vappsvaptanvapulate
vapulationvaquerovaquitavar
varèsevar.varavaractor
varahavarak, qazvinvaralaruvaran
varanasivarangianvarangiansvaranid
varanidaevaranoidvaranusvaranus komodoensis
varanus niloticusvarcharvarcovardapet
vardarvarde municipalityvardenafilvardo
vardonvard\u00f8vardøvare
varecvarenvareniclinevarennes
varennesitevarentecvarenykyvareš
varesevargvargavargas
vargas llosavargas, venezuelavarivaria
variabilityvariablevariable antshrikevariable binding
variable costvariable periodvariable quantityvariable resistor
variable starvariable statevariable tandem rep…variable-pitch prop…
variable-ratevariablenessvariablesvariably
variadicvarian semiconducto…variancevariance inflation …
variantvariant surface gly…variantevariar
variașvariatevariationvariation of the co…
variation ratiovariation selectorvariationalvariationally
variationistvariationsvaricealvaricella
varicella zoster vi…varicelliformvaricellovirusvarices
variciformvarick media manage…varico-varicocele
varicocelectomyvaricoloredvaricolouredvaricose
varicose ulcervaricose veinvaricose veinsvaricosis
varicosityvaricotomyvaricousvaried
varied lorikeetvariedlyvariednessvariegate
variegatedvariegated horsetailvariegated scouring…variegated star mac…
variegated tinamouvariegatingvariegationvarier
varietalvarietallyvarietasvarieties
varietistvarietyvariety is the spic…variety meat
variety showvariety storevarifocalvarifocal lens
varifocalsvarifoldvariformvariformed
varifyvarigvarillavarimax
variogramvariolavariola majorvariola major virus
variola minorvariola minor virusvariola vaccinavariola vaccine
variola vacciniavariola virusvariolarvariolate
variolationvariolicvariolitevariolitic
variolizationvarioloidvariolousvariomatic
variometervariorumvariorum editionvarious
various productionvariouslyvariously-leaved po…variousness
variscitevarissevaristorvarity
varixvarkvarkalavarlet
varletryvarley's condenservarley's resistancesvarma
varmentvarminvarmintvarmint hunting
varmintervarmour networksvarnavarnhagen, von ense
varnishvarnish treevarnish, electricvarnish, red
varnishablevarnishedvarnishervarnishing
varnishlessvarnishlikevaroliivaronis systems
varrovarro, marcus teren…varroavarroatosis
varroidaevarsvarsalvarsity
varsity lettervarsity news networkvarsity sockvarsovian
varsoviennevartabedvarulitevaruna
varuqvarusvarus, publius quin…varve
varveevarvelvarveledvary
varyingvarying harevaryinglyvas
vas countyvas deferensvas-vasa
vasa brevisvasa deferentiavasa efferentiavasa nervorum
vasa praeviavasa previavasa vasorumvasaloppet
vasalsvasarelyvasarivasari, giorgio
vasco da gamavasco da gammavasco nunez de balb…vascon
vasconcelleavasconesvasconicvasconist
vasculavascularvascular bundlevascular cambium
vascular capacitancevascular cell adhes…vascular diseasevascular diseases
vascular endothelia…vascular endothelia…vascular endothelia…vascular endothelia…
vascular endothelia…vascular endothelia…vascular endothelia…vascular endothelia…
vascular endothelia…vascular endothelia…vascular fistulavascular headaches
vascular hemophiliavascular magneticsvascular malformati…vascular neoplasms
vascular patencyvascular pharmaceut…vascular plantvascular ray
vascular resistancevascular spidervascular strandvascular stroma
vascular structurevascular surgical p…vascular systemvascular therapeuti…
vascular tissuevascularisationvascularisevascularities
vascularityvascularizationvascularizevasculature
vasculiticvasculitisvasculitis, central…vasculitis, leukocy…
vasculogenesisvasculogenicvasculopathyvasculoprotection
vasculoprotectivevasculosevasculumvase
vase vinevase-finevase-shapedvasectomise
vasectomizevasectomyvasefulvaselike
vaselinevashegyitevashtivasiform
vasilitevasilyevitevaslav nijinskyvaso
vaso-vaso-inhibitoryvasoactivevasoactive intestin…
vasoarrhythmiavasocongestionvasocongestivevasoconstricting
vasoconstrictionvasoconstrictivevasoconstrictorvasoconstrictor age…
vasodentinevasodilatationvasodilatevasodilation
vasodilativevasodilatorvasodilator agentsvasodilatory
vasoendothelialvasoformativevasogenixvasoinhibitory
vasomaxvasomodulationvasomotionvasomotor
vasomotor systemvasona networksvasonovavasoplegia
vasoplegic syndromevasopressinvasopressinsvasopressor
vasorelaxantvasorelaxationvasosectionvasospasm
vasospasm, intracra…vasotecvasotocinvasotomy
vasovagalvasovasostomyvasovesiculitisvass
vassavassalvassalagevassaldom
vassalessvassalicvassalryvassar
vassar collegevassevasselvast
vast right-wing con…vast systems techno…vastasvastation
vastelvasthyvastidityvastitude
vastityvastlyvastnessvasto
vastonvastyvasuvasuki
vasumvatvat colorvat dye
vatablevatanvatervaterite
vateriticvatesvatfulvatfuls
vathecvaticvaticalvatican
vatican cityvatican councilvatican palacevatican roulette
vatican, thevaticanismvaticanistvaticidal
vaticidevaticinalvaticinatevaticination
vaticinatorvaticinatoryvaticinevatinian
vativ technologiesvatmanvatovatos
vatrushkavatsvattedvatting
vattnäsvatuvauban, sebastien l…vaucluse
vaudvaudevillevaudeville theatervaudeville theatre
vaudevillelikevaudevillianvaudevilliansvaudois
vaudouxvaughanvaughan williamsvaughan, charles jo…
vaughan, henryvaughan, herbert, c…vaughnvaughnite
vaultvault of heavenvault ribonucleopro…vault-worthy
vaultagevaultedvaultervaultful
vaultingvaulting horsevaulting schoolvaultive
vaultlikevaultlogixvaultus mobilevaulty
vauncevauntvaunt-couriervaunte
vauntedvauntervauntfulvaunting
vauntinglyvauntmurevauquelinitevaurien
vautvautyvauvenargues, marqu…vaux
vauxhallvauxitevavvavasor
vavasoryvavasourvavlevaward
vaxvaxartvaxcarevaxen
vaxess technologiesvaxinnatevaxocentrismvay
vayavayablevaykvayots dzor
vayots dzor provincevayuvayusavaza parrot
vazata   

The Web's Largest Resource for

Definitions & Translations


A Member Of The STANDS4 Network