Found 1,603 definitions starting with VA:

vava-jay-jayva-va-voomva.
vaadvaagmervaalvaaljapie
vaasavacvacanciesvacancy
vacancy defectvacancy ratevacantvacant lot
vacantlyvacantnessvacatevacated
vacatiavacatingvacationvacation bible scho…
vacation dayvacation homevacation listing se…vacation spot
vacationervacationfuturesvacationingvacationist
vacationlandvacaturvacavillevaccaria
vaccaria hispanicavaccaria pyramidatavaccaryvaccenic
vaccenic acidvaccenylvaccenyl acetatevaccimulgence
vaccinavaccinablevaccinalvaccinate
vaccinatedvaccinatingvaccinationvaccination mark
vaccinationlikevaccinatorvaccinevaccinee
vaccinesvaccines, acellularvaccines, attenuatedvaccines, combined
vaccines, conjugatevaccines, contracep…vaccines, dnavaccines, edible
vaccines, inactivat…vaccines, markervaccines, subunitvaccines, synthetic
vaccines, virosomevacciniavaccinia gangrenosavaccinia virus
vaccinistvacciniumvaccinium angustifo…vaccinium arboreum
vaccinium asheivaccinium caespitos…vaccinium corymbosumvaccinium macrocarp…
vaccinium myrsinitesvaccinium myrtillusvaccinium ovatumvaccinium oxycoccus
vaccinium pallidumvaccinium parvifoli…vaccinium pennsylva…vaccinium scoparium
vaccinium stamineumvaccinium uliginosu…vaccinium virgatumvaccinium vitis-ida…
vaccinogenvaccinologistvaccinologyvaccinum
vaccsysvačevachel lindsayvachellia
vachellia farnesianavachervacheressevacherie
vacherinvacheryvacillancyvacillant
vacillatevacillatedvacillatingvacillatingly
vacillationvacillatorvacillatoryvacivity
vaclavvaclav havelvacuavacuate
vacuationvacuistvacuityvacuna
vacuolarvacuolar proton-tra…vacuolatevacuolated
vacuolationvacuolevacuolesvacuolic
vacuolinvacuolisationvacuolizationvacuous
vacuouslyvacuousnessvacutainervacuum
vacuum aspirationvacuum bagvacuum bombvacuum bottle
vacuum chambervacuum cleanervacuum cleaner exte…vacuum cleaner repl…
vacuum curettagevacuum decayvacuum desiccatorvacuum distillation
vacuum energyvacuum extraction, …vacuum flaskvacuum fluorescent …
vacuum formingvacuum gagevacuum gaugevacuum pump
vacuum tubevacuum, absolutevacuum, highvacuum, low
vacuum, partialvacuum, torricellianvacuum-cleanvacuum-packed
vacuumablevacuumlikevacuumsvada
vada pavvadantesvaddingvaddio
vadevade mecumVade-mecumvader
vadgevadivadiavadimony
vadiovadiumvadovadodara
vadosevadouvanvadsøvaduz
vadvervaevaesitevafrous
vagvagabondvagabondagevagabonding
vagabondishvagabondismvagabondizevagabondry
vagabondsvagalvagallyvagancy
vagantesvaganzavágarvagaries
vagariousvagarityvagarosavagary
vagationvågevagientvagile
vagilityvaginavagina dentatavagina envy
vagina tendinisvaginaevaginalvaginal artery
vaginal birthvaginal birth after…vaginal condomvaginal creams, foa…
vaginal dischargevaginal diseasesvaginal douchingvaginal fistula
vaginal flatulencevaginal fluidvaginal neoplasmsvaginal ring
vaginal sexvaginal smearvaginal smearsvaginaless
vaginalikevaginalitisvaginallyvaginant
vaginasvaginatevaginatedvaginati
vaginatoidvaginectomyvaginervosevaginicola
vaginismusvaginitisvaginocelevaginopennous
vaginoplastyvaginosisvaginosis, bacterialvaginula
vaginulevaginævagissatevagitus
vagitus uterinusvagliavagn walfrid ekmanvago-
vagotomyvagotomy, proximal …vagotomy, truncalvagotonia
vagousvagrancyvagrantvagrantly
vagrantnessVagromvaguevagueish
vaguelyvaguenessvagueryvaguish
vagusvagus nervevagus nerve diseasesvagus nerve stimula…
váhvahagnvahanavaho
vaivai peoplevaidadeVaidic
vaievaigatzvailvailer
vaillantvaillantevaimurevain
väinämöinenvaingloriousvaingloriouslyvaingloriousness
vaingloryvainillavainlyvainness
vainsvairvairagyavairy
vaisakhavaisakhivaishakvaisheshika
vaishnavavaishnavasvaishnavismvaishya
vaisnavaravaisnavismvaison-la-romainevaisya
vaisyasvaivodevajazzlevajdakite
vajpayeevajravajrayanavåk
vakaVakassVakevakeel
vakilvalval badiaval.
valavalaciclovirvalaisvalance
valance boardvalancedvalancelikevalancing
valandovovalant medical solu…valarivalarie
valchemyvaldavaldai hillsvaldecoxib
valdezvaldiviavaldostavale
vale of tearsvale of tempevaledictionvaledictorian
valedictoriesvaledictoryvaledictory addressvaledictory speaker
valen technologiesvalencevalence bandvalence bond
valence electronvalence healthvalence isomervalence issue
valence shellvalence technologyvalencellvalencene
valenciavalencia orangevalencianvalencian community
valenciennesvalenciennes lacevalenciesvalency
valenkivalensvalens, flaviusvalent
valentivalentiavalentinvalentina
valentina tereshkovavalentina vladmirov…valentinevalentine day
valentine's dayvalentine, basilvalentinelessvalentines card
valentines dayvalentines day giftvalentinivalentinian
valentinian ivalentinian i.valentiniansvalentinite
valentinovalentino pascuccivalentinusvalenza
valeo medicalvålervaleravaleral
valeraldehydevaleramidevaleratevalerates
valerenevaleriavaleria messalinavalerian
valerian familyvalerianavaleriana officinal…valerianaceae
valerianaceousvalerianatevalerianellavalerianella locusta
valerianella olitor…valerianicvaleriano weylervalerianus, lucinius
valericvaleric acidvaleridinevalerie
valerie carrvalerinvalerion therapeuti…valeritas
valeritrinevaleriusvalerius maximusvalero
valero-valerolvaleronevalerophenone
valéryvalerylvalerylenevalet
valet de chambrevalet parkingvalet-de-chambrevalete
valettavalette, cantalvalette, jean paris…valetudinarian
valetudinarianismvaletudinaryvaletudinousvalfroicourt
valga, estoniavalganciclovirvalgorgevalgus
valhallavalhuonvalivaliance
valiancyvaliantvaliant healthvaliantly
valiantnessvalidvalid claimvalidas
validatablevalidatevalidatedvalidating
validationvalidation master p…validation studiesvalidation studies …
validation therapyvalidatorvalidatoryvalidify
validityvalidlyvalidnessvalidus
validus dc systemsvalidus dc systems,…valientevaliha
valinchvalinevaline dehydrogenas…valine-trna ligase
valinesvalinomycinvalisvalise
valiselikevaliumvaljeanvalka
valknutvalkyrvalkyriavalkyrian
valkyrievalkyrie computer s…valkyrielikevalkyrs
vallavalla, laurencevalladolidvallai
vallancyvallarvallaryvallat
vallataVallatevallationvallatory
vallaurisvalle d'aostavalle daostavalle, norway
valleculavalleculaevallecularvallegrande
vallejovallenarvallenatovalleriite
valleryvallèsvalles marinerisvallet
vallet's pillsvallettavalleyvalley boy
valley fevervalley fillvalley forgevalley girl
valley miwokvalley oakvalley of deathvalley of ten thous…
valley of the kingsvalley of the shado…valley pocket gophervalley river
valley white oakvalleyfieldvalleysvalleyspeak
valleytronicsvalleywardvalleywardsvalli
valliantvallisvallisneriavallisneria america…
vallisneria spiralisvallombrosavallombrosa abbeyvallon
vallumvallumsvalmarcvalmiki
valmyvalnemulinvalofanevalognes
valoisvalonavaloniavalor
valoresvalorisationvalorizevalorous
valorouslyvalorousnessvalourvalparaiso
valpovalpolicellavalproatevalproic
valproic acidvalpromidevalrubicinvals
valsalva maneuvervalsalvianvalsartanvalse
valsesvalspeakvaltronicvaluable
valuable cargovaluablenessvaluablesvaluably
valuatevaluationvaluation accountvaluation function
valuation reservevaluativevaluatorvalue
value addedvalue added taxvalue at riskvalue bet
value chainvalue championvalue datevalue domain
value drivenvalue driversvalue for moneyvalue formula
value industry cham…value investingvalue judgementvalue judgment
value managementvalue manager - ass…value manager - fel…value manager - pro…
value managersvalue of lifevalue orientationvalue over replacem…
value propositionvalue raisevalue statementvalue system
value theoryvalue typevalue votervalue-add
value-addedvalue-added networkvalue-added resellervalue-added tax
value-systemvalueappealvalueclickvalued
valuelessvaluelesslyvaluelessnessvalueness
valuervaluesvalues of nvaluing
valunetvalurevalvavalvai
valvasorvalvatavalvatevalve
valve oilvalve rockervalve trainvalve, electrically…
valve-in-head enginevalve-shellvalvedvalveless
valveletvalvelikevalverde provincevalvetrain
valvettithuraivalvexchangevalvoplastyvalvotomy
valvulavalvulaevalvularvalvular heart dise…
valvular incompeten…valvulevalvulitisvalvulopathy
valvuloplastyvalvulotomyvalylvalylene
valzinvambasiumvambéry, arminiusvambrace
vamovamoosevamoose busvamos
vamosevampvamp communicationsvamp up
vampedvampervampilyvampiness
vampingvampirevampire batvampiredom
vampirelikevampiresvampiresquevampiress
vampirettevampireyvampiricvampirical
vampiricallyvampirisationvampirisevampirish
vampirismvampiristvampirizationvampirize
vampirovampirologicalvampirologistvampirology
vampishvampishlyvampishnessvamplate
vampsvampyvampyrvamure
vanvan allenvan allen beltvan allen radiation…
van beethovenvan bogaert encepha…van burenvan buren, martin
van de graaffvan de graaff gener…van de veldevan der hum
van der waal's forc…van der waalsvan der waals forcevan der waals' forc…
van diemenvan diemen's landvan diemens landvan doren
van dyckvan eyckvan gilder insurancevan god los
van goghvan rensselaervan tranvan vleck
van wyck brooksvan't hoffvan-couriervanad
vanadatevanadatesvanadatianvanadia
vanadianvanadiatevanadicvanadic acid
vanadiferousvanadinitevanadiocarpholitevanadious
vanaditevanadiumvanadium bromoperox…vanadium chromagen
vanadium compoundsvanadium pentoxidevanadium steelvanadium-50
vanadium-51vanadium-associated…vanadiumdravitevanadoan
vanadocytevanadomalayaitevanadousvanadous acid
vanadylvanadyl acetylaceto…vanadylianvanalite
vanaspativanbrughvanbrugh, sir johnvance
vancian magicvancocinvancomycinvancomycin resistan…
Vancouriervancouvervancouver islandvancouver island ma…
vancouveritevandavanda coeruleavandal
vandalia researchvandalicvandalic languagevandalisation
vandalisevandalisedvandalismvandalistic
vandalizationvandalizevandalizedvandalous
vandalsvandenbergvandenberg catalystvandenbrandeite
vandendriesscheitevanderbiltvanderbilt, corneli…vandeveldt, william
vandorenvandré sagrilo mon…vandyck, sir anthonyvandyke
vandyke beardvandyke brownvandyke collarvandyne superturbo
vanevane, sir henryvanedvanellus
vanernvanesvanessavanessa atalanta
vanessa bellvanessa stephenvanessa virginiensisvanessian
vanettevanfessvanfulvang
vang, opplandvangavangard voice syste…vangaži
vangelovanglovangogh imagingvanguard
vanguardiavanguardismvanguardistvanguards of conque…
vangueriavangueria infaustavangueria madagasca…vani
vaniervanillavanilla beanvanilla extract
vanilla ice creamvanilla orchidvanilla planifoliavanilla pudding
vanilla sexvanilla slicevanillatevanillekipferl
vanillicvanillic acidvanillinvanilloes
vanilloidvanillylvanillyl groupvaniloquence
vaniloquentvanirvanishvanished
vanishervanishingvanishing creamvanishing point
vanishinglyvanishmentvanitasvanities
vanitizevanityvanity casevanity domain
vanity fairvanity license platevanity numbervanity plate
vanity pressvanity publishervanity publishingvanity table
vanjasvanlikevanloadvanmeersscheite
vannevannervanner hawkvannes
vannevarvannevar bushvanningvano language
vanoxerinevanoxitevanpoolvanquish
vanquish oncologyvanquishablevanquishedvanquisher
vanquishingvanquishmentvansvansire
vantvant-couriervantaavantage
vantage hospicevantage mediavantage pointvantageilm
vantasselitevantbracevantbrassvanthoffite
vantosvanuvanuavanua levu
vanuatuvanuatuanvanuralitevanward
vany, francevanyavanzettivap
vapaliximabvaphiovapidvapidity
vapidlyvapidnessvaporvapor barrier
vapor bathvapor densityvapor globevapor lock
vapor pressurevapor retardervapor trailvaporability
vaporablevaporatevaporationvapore
vaporedvaporervaporettovaporiferous
vaporificvaporiformvaporimetervaporing
vaporisationvaporisevaporisedvaporish
vaporizablevaporizationvaporizevaporized
vaporizervaporizingvaporlikeVaporole
vaporosevaporousvaporousnessvapors
vaporwarevaporwirevaporyvapotherm
vapourvapour bathvapour densityvapour lock
vapour pressurevapour trailvapourervapourette
vapourishvapoursvapourwarevapoury
vappodesvappodes phalaenops…vappsvaptan
vapulatevapulationvaqueirosvaquero
vaquitavarvarèsevar.
varavaractorvaradavaraha
varak, qazvinvaralaruvaranvaranasi
varangianvarangiansvaranidvaranidae
varanoidvaranusvaranus komodoensisvaranus niloticus
varcharvarcovardavardapet
vardarvarde municipalityvardenafilvardo
vardonvardøvarevarec
varenvareniclinevarennevarennes
varennesitevarentecvarenykyvareš
vareseVareusevargvarga
vargasvargas llosavargas, venezuelaVargueno
varivariavariabilityvariable
variable antshrikevariable bindingvariable costvariable period
variable quantityvariable resistorvariable starvariable state
variable tandem rep…variable-pitch prop…variable-ratevariableness
variablesvariablyvariadicvarian semiconducto…
variancevariance inflation …variantvariant surface gly…
variantevariarvariașvariate
variationvariation of the co…variation ratiovariation selector
variationalvariationallyvariationistvariations
varicealvaricellavaricella zoster vi…varicelliform
varicellovirusvaricesvariciformvarick
varick media manage…varico-varicocelevaricocelectomy
varicoloredvaricolouredVaricornvaricose
varicose ulcervaricose veinvaricose veinsvaricosis
varicosityvaricotomyvaricousvaried
varied lorikeetvariedlyvariednessvariegate
variegatedvariegated horsetailvariegated scouring…variegated star mac…
variegated tinamouvariegatingvariegationvarier
varietalvarietallyvarietasvarieties
varietistvarietyvariety is the spic…variety meat
variety showvariety storevarifocalvarifocal lens
varifocalsvarifoldvariformvariformed
varifyvarigvarillavarimax
variogramvariolavariola majorvariola major virus
variola minorvariola minor virusvariola vaccinavariola vaccine
variola vacciniavariola virusvariolarvariolate
variolationvariolicvariolitevariolitic
variolizationvarioloidvariolousvariomatic
variometervariorumvariorum editionvarious
various productionvariouslyvariously-leaved po…variousness
variscitevarissevaristorvarity
varixvarkvarkalavarlet
varletryvarley's condenservarley's resistancesvarma
varmentvarminvarmintvarmint hunting
varmintervarmour networksvarnavarney
varnhagen, von ensevarnishvarnish treevarnish, electric
varnish, redvarnishablevarnishedvarnisher
varnishingvarnishlessvarnishlikevarolii
varonis systemsVarriatedvarrovarro, marcus teren…
varroavarroatosisvarroidaevars
varsalvarsityvarsity lettervarsity news network
varsity sockvarsovianvarsoviennevartabed
varulitevarunavaruqvarus
varus, publius quin…varvevarveevarvel
varveledVarvelsvaryvarying
varying harevaryinglyvasvas county
vas deferensvas-vasavasa brevis
vasa deferentiavasa efferentiavasa nervorumvasa praevia
vasa previavasa vasorumVasaliumvasaloppet
vasalsvasarelyvasarivasari, giorgio
vasco da gamavasco da gammavasco nunez de balb…vascon
vasconcelleavasconesvasconicvasconist
vasculavascularvascular bundlevascular cambium
vascular capacitancevascular cell adhes…vascular diseasevascular diseases
vascular endothelia…vascular endothelia…vascular endothelia…vascular endothelia…
vascular endothelia…vascular endothelia…vascular endothelia…vascular endothelia…
vascular endothelia…vascular endothelia…vascular fistulavascular headaches
vascular hemophiliavascular magneticsvascular malformati…vascular neoplasms
vascular patencyvascular pharmaceut…vascular plantvascular ray
vascular resistancevascular spidervascular strandvascular stroma
vascular structurevascular surgical p…vascular systemvascular therapeuti…
vascular tissuevascularisationvascularisevascularities
vascularityvascularizationvascularizevasculature
vasculiticvasculitisvasculitis, central…vasculitis, leukocy…
vasculogenesisvasculogenicvasculopathyvasculoprotection
vasculoprotectivevasculosevasculumvase
vase vinevase-finevase-shapedvasectomise
vasectomizevasectomyvasefulvaselike
vaselinevashegyitevashtivasiform
vasilitevasilyevitevaslav nijinskyvaso
vaso-vaso-inhibitoryvasoactivevasoactive intestin…
vasoarrhythmiavasocongestionvasocongestivevasoconstricting
vasoconstrictionvasoconstrictivevasoconstrictorvasoconstrictor age…
vasodentinevasodilatationvasodilatevasodilation
vasodilativevasodilatorvasodilator agentsvasodilatory
vasoendothelialvasoformativevasogenixvasoinhibitory
vasomaxvasomodulationvasomotionvasomotor
vasomotor systemvasona networksvasonovavasoplegia
vasoplegic syndromevasopressinvasopressinsvasopressor
vasorelaxantvasorelaxationvasosectionvasospasm
vasospasm, intracra…vasotecvasotocinvasotomy
vasovagalvasovasostomyvasovesiculitisvass
vassavassalvassalagevassaldom
vassalessvassalicvassalryvassar
vassar collegevassevasselvast
vast right-wing con…vast systems techno…vastasvastation
vastelvasthyvastidityvastitude
vastityvastlyvastnessvasto
vastonvastyvasuvasuki
vasumvatvat colorvat dye
vatablevatanvatervaterite
vateriticvatersayvatesvatful
vatfulsvathecvaticvatical
vaticanvatican cityvatican councilvatican palace
vatican roulettevatican, thevaticanismvaticanist
vaticidalvaticidevaticinalvaticinate
vaticinationvaticinatorvaticinatoryvaticine
vatinianvativ technologiesvatmanvato
vatosvatrushkavatsvatted
vattingvattnäsvatuvauban, sebastien l…
vauclusevaucouleursvaudvaudeville
vaudeville theatervaudeville theatrevaudevillelikevaudevillian
vaudevilliansvaudoisVaudoovaudoux
vaughanvaughan williamsvaughan, charles jo…vaughan, henry
vaughan, herbert, c…vaughnvaughnitevault
vault of heavenvault ribonucleopro…vault-worthyvaultage
vaultedvaultervaultfulvaulting
vaulting horsevaulting schoolvaultivevaultlike
vaultlogixvaultus mobilevaultyvaunce
vauntvaunt-couriervauntevaunted
vauntervauntfulvauntingvauntingly
vauntmurevauquelinitevaurienvaut
vautyvauvenargues, marqu…vauxvauxhall
vauxitevavvavasorvavasory
vavasourvavlevawardvax
vaxartvaxcarevaxenvaxess technologies
vaxinnatevaxocentrismvayvaya
vaya con diosvayablevayasvayk
vayots dzorvayots dzor provincevayots dzor regionvayu
vayusavaza parrotvazata