Found 1,737 definitions starting with TI:

titi plantti plasmidtia
tia mariatiaa, wife of seti …tiaa, wife of sety …tiabendazole
tiadenoltiamattiamulintian
tian shantian-shantiana, sardiniatiananmen
tiananmen squaretianeptinetianjintianjin preserved v…
tiapridetiaprofenic acidtiartiara
tiaraedtiaraliketiaretiarella
tiarella cordifoliatiarella unifoliatatiazofurintib-cat
tibbietibea languagetibertiberian
tiberiastiberiustiberius claudius d…tiberius claudius n…
tibersofttibert, sirtibettibet autonomous re…
tibetantibetan alphabettibetan antelopetibetan buddhism
tibetan foodtibetan foxtibetan mastifftibetan sand fox
tibetan scripttibetan spanieltibetan terriertibeto-
tibeto-burmantibeto-burman langu…tibeto-burman langu…tibia
tibia valgatibia varatibiaetibial
tibial arteriestibial nervetibial neuropathytibial vein
tibialetibialiatibialistibialis anterior
tibialis anticustibialis muscletibialis posteriortibialis posticus
tibicentibicinatetibiiformtibio-
tibiofemoraltibion bionic techn…tibiotarsaltibiotarsi
tibiotarsustibnitibolonetibor
tibouchinatibrietibullustibullus, albius
tiburtiburcio carías an…tiburontic
tic disorderstic douloureuxtic tactic tac toe
tic-tactic-tac-toeticalticarcillin
ticeticementtichtichborne
ticheltichotichodromatichodroma muriaria
tichodrometichorrhineticilimumabticino
ticktick (someone) offtick awaytick box
tick controltick downtick fevertick infestations
tick list featurestick marktick offtick over
tick paralysistick tocktick toxicosestick trefoil
tick! tack!tick-borne diseasestick-borne encephal…tick-tack-toe
tick-tocktick-weedtickabletickborne
tickedticked offtickell, thomasticken
tickengotickerticker symbolticker tape
ticker tape paradeticker-tape paradeticketticket agent
ticket bookticket boothticket caketicket collector
ticket evolutionticket holderticket inspectorticket line
ticket officeticket stubticket takerticket tout
ticket windowticket-collectorticket-holderticket-of-leave
ticketbiscuitticketedticketflyticketing
ticketleapticketlessticketlessnessticketmaster
ticketsticketsnowticketstumblertickety&hyph;boo
tickety-bootickeytickingticking bomb
ticking-offticking-overtickletickle a bug
tickle pinktickle somebodys fu…tickle someones fan…tickle the ivories
tickle-footedtickle.comtickledtickled pink
ticklenburgticklenessticklertickler coil
tickler fileticklingticklinglyticklish
ticklishlyticklishnessticklyticknor, george
tickpicktickstickseedtickseed sunflower
ticktackticktacktoeticktacktooticktock
tickweedtickyticky tackyticky-tacky
ticlatoneticlopidineticoticonderoga
ticpolongaticrynafenticstictac
tidtidaltidal basintidal bore
tidal currenttidal energytidal flattidal flow
tidal forcetidal islandtidal lockingtidal power
tidal rangetidal rivertidal streamtidal volume
tidal wavetidal wavestidal zonetidalite
tidallytidally lockedtidalwave tradertidbit
tidbitstiddetiddertiddle
tiddledtiddledy winkstiddlertiddley
tiddlytiddlywinktiddlywinkstide
tide daytide dialtide gatetide gauge
tide locktide milltide overtide rip
tide tabletide waitertide wheeltide-rode
tidedtidelandtideland signal cor…tideless
tidelessnesstideliketidelinetidemark
tideovertidepooltidesmantidesmen
tidewaitertidewatertidewater rivertidewater stream
tidewaytidewracktidgytidied
tidiertidiestidifetidily
tidinesstidingtidingstidley
tidley winkstidologytidytidy sum
tidy tipstidy uptidy whitiestidy-up
tidyingtidytipstietie (someone) down
tie backtie beamtie clasptie clip
tie downtie down diagramtie down pointtie down point patt…
tie dyetie intie in withtie in/up
tie one ontie racktie rodtie someones hands
tie tacktie the knottie uptie up loose ends
tie wraptie-dyetie-dyeingtie-in
tie-ontie-rodtie-uptieback
tieback walltiebartiebeamtiebreak
tiebreakertiebreakingtieck, ludwigtied
tied housetied uptiefertiefland
tiefschwarztieingtielesstiemaker
tiemannitetiempotientien shan
tien-paotiene languagetienilic acidtiens biotech group
tienshanitetientotientsintiepin
tiepolotiertier 1 performancetier 3
tier uptiercetierce de picardietierce-major
tiercedtierceltiercelettiercet
tierc\u00e9tieredtiered seatstiergarten
tierparktierratierra amarillatierra caliente
tierra del fuegotierstiers étatties
tiëstotieticktiettaitetietze's syndrome
tiewigtiferettifftiffany
tiffany glasstiffedtiffintiffing
tiffishtiffs treats holdin…tifinaghtiflis
tifotifttigtiga
tigatuzumabtigecyclinetigellatigelle
tigemonamtigertiger beetletiger bread
tiger cattiger cowrietiger cubtiger economy
tiger kidnaptiger lilytiger mothtiger prawn
tiger rattlesnaketiger salamandertiger sharktiger snake
tiger swallowtailtiger teamtiger's eyetiger's-eye
tiger's-foottiger-eyetiger-foottiger-footed
tigerdomtigerfishtigerhoodtigerine
tigerishtigerishlytigerishnesstigerlike
tigerstigers eyetigerstripetigertext
tigerwoodtiggertiggytigh
tighttight as a ducks ar…tight as a ticktight binding
tight endtight fittight fivetight junction
tight junctionstight lipstight looptight money
tight shiptight spottight-fistedtight-fitting
tight-knittight-lacedtight-lippedtight-lippedness
tightasstightdbtightentighten one's belt
tighten ones belttighten the purse s…tighten uptightened
tightenertighteningtightertightfisted
tightfistednesstightheadtightie-whitiestightish
tightlacertightlacingtightlippedtightlippedness
tightlytightly fittingtightly knittightness
tightropetightrope walkertightrope walkingtights
tightwadtightwaditytighty whitiestiglath-pileser iii
tiglictiglic acidtiglontignon
tigo energytigogenintigontigre
tigreantigresstigrinetigrinya
tigristigris pharmaceutic…tigris rivertigrish
tijdtijuanatiktik-tok
tikaltikar peopletiketikhonenkovite
tikitikitikitikkatikka masala
tikkuntikkun leil shavuottikkun olamtikl
tikoloshetikrittikustil
til death do us parttil nowtil treetila
tilaktilapiatilapia niloticatilasite
tilawatilburgtilburiestilbury
tilbury forttildatildetilden
tiletile cuttertile rooftile saw
tile trackingtile-draintilebasedtiled
tilefishtilelesstileliketilemaker
tilemakingtilertileratileries
tilerytilestilesettilestone
tiletaminetileworktilfordtilia
tilia americanatilia cordatatilia heterophyllatilia japonica
tilia tomentosatiliaceaetiliaceoustilidate
tilidinetilingtiliomycetestill
till thentillabletillagetillandsia
tillandsia usneoidestilledtilled landtiller
tiller extensiontilleredtilleringtillerman
tillettilletiatilletia cariestilletia foetida
tilletiaceaetilleytilley seedtilleyite
tillichtillietillingtillite
tillmantillmentillodonttillodontia
tillotson, john rob…tillowtillytilly, johann tserk…
tilly-vallytilmustiloronetilr
tilsittilsttilttilt angle
tilt at windmillstilt barriertilt hammertilt rail
tilt testtilt-milltilt-table testtilt-top table
tilt-uptilt-yardtiltabletilted
tiltertilthtiltingtilting board
tiltmetertiltoramatiltrotortilty
tiltyardtimtim armstrongtim leary
tim marshalltim-whiskeytim.timaeus
timaltimaliatimaliidaetimaline
timartimariottimawatimba
timbaltimbaletimbale casetimbalero
timbalestimballotimbautimbe language
timbertimber camptimber framingtimber hitch
timber linetimber raftingtimber rattlesnaketimber wolf
timber yardtimber-framedtimber-raftingtimberdoodle
timberedtimberheadtimberingtimberlake
timberlandtimberlesstimberliketimberline
timberlingtimbermantimbermentimberwork
timberyardtimbittimbotimbral
timbretimbreltimbreledtimbreless
timbrelisttimbrelledtimbrictimbro
timbromaniatimbuctootimbuktutimbuktu labs
timburinetimetime after timetime and (time) aga…
time and a halftime and againtime and materialtime and motion stu…
time and motion stu…time and tidetime and tide wait …time and time again
time attacktime averagetime balltime being
time belttime billtime bombtime bomb deals
time capsuletime clocktime codetime complexity
time constanttime constrainttime cut-outstime delay
time deposittime deposit accounttime differencetime dilatation
time dilationtime domaintime drafttime exposure
time factorstime fliestime flies when you…time for bed
time frametime fuzetime heals all woun…time horizon
time immemorialtime intervaltime istime is money
time is of the esse…time is running outtime killertime lag
time lapsetime limittime linetime loan
time locktime machinetime managementtime note
time of arrivaltime of attacktime of daytime of departure
time of flighttime of lifetime of origintime of pitch
time of the monthtime of yeartime offtime on target
time outtime out of mindtime perceptiontime period
time plantime preferencetime reversaltime scale
time seriestime servedtime servertime share
time sharingtime sheettime shiftingtime signal
time signaturetime sinktime slicetime slot
time spreadtime standardtime stands stilltime stream
time studytime ttime testtime to cater
time to cometime to killtime to markettime to target
time to timetime traveltime trialtime trialist
time tunneltime unittime valuetime value of money
time warptime zonetime-and-motion stu…time-ball
time-consumingtime-definite deliv…time-delay measurin…time-delay measurin…
time-dependenttime-falltime-fusetime-honored
time-honouredtime-independenttime-invarianttime-lag
time-lapsetime-lapse photogra…time-limittime-line
time-motion studytime-of-flighttime-of-flight mass…time-out
time-phased force a…time-phased force a…time-phased force a…time-phased force a…
time-reactiontime-risetime-savingtime-scale factor
time-sensitive targ…time-servingtime-sharetime-sharing
time-slicingtime-space converge…time-stamptime-switch
time-tabletime-testedtime-travellertime-waster
time-weightedtime-worntimebombtimebook
timeboundtimeboxtimebridgetimecard
timecodetimecoursetimedtimed out
timed texttimed-releasetimefultimehop
timekeepertimekeeperstimekeepingtimelab
timelapsetimelesstimeless existencetimelessly
timelessnesstimeliketimelikenesstimelily
timelinetimelinestimelinesstimeling
timelordtimelytimenoguytimeoff
timeoustimeouslytimeouttimepass
timepiecetimepleasertimepointtimeproof
timertimestimes or divided bytimes sign
times squaretimes tabletimesavertimesaving
timescapetimesetimeservertimeserving
timesharetimeshare broker sa…timesharingtimesheet
timesight systemstimesliptimeslottimespan
timestamptimesteptimestreamtimetable
timetrade systemstimewarptimewastingtimewave
timeweightedtimewisetimeworktimeworn
timexchangetimezonetime–space compre…timgad
timitimişoaratimidtimidity
timidity++timidlytimidnesstimidous
timimountimingtiming belttiming is everything
timiskamingtimisoaratimisttimi\u015foara
timmertimminstimmotimmy
timnodonictimnodonic acidtimocracytimocratic
timoleontimololtimontimon of phlius
timoneertimonismtimonisttimonization
timonizetimophiliatimortimor sea
timor-lestetimoresetimoroustimorously
timorousnesstimorsometimotheustimothy
timothy francis lea…timothy grasstimothy learytimothy miles bindo…
timoustimpanitimpanisttimpano
timpanumtimpletimucutimucua
timurtimur lenktimur the tartartimzon
tintin a metal; one of…tin boxtin can
tin compoundstin crytin cuptin disease
tin dogtin eartin fluoridestin foil
tin foil hattin godtin hattin knocker
tin lizzietin mantin mentin opener
tin pan alleytin parachutetin pesttin plague
tin platetin polyphosphatestin pyritestin radioisotopes
tin sandwichtin soldiertin sounderstin tabernacle
tin whistletin yin leuntin(ii) fluoridetin-foil hat
tin-openertin-platetin-platingtin-pot
tin-pot dictatortinatinajatinajas
tinaksitetinamidaetinamidestinamiformes
tinamoutinbergentinctinca
tinca tincatincaltincalconitetinchel
tincladtincttinct.tinctorial
tincturatincturationtincturetincture of iodine
tincture of opiumtincturedtincturingtind
tindaltindal, matthewtindaletindall
tindertinderboxtinderytindie
tindoratindyebwa agaba wisetinetine test
tineatinea barbaetinea capitistinea corporis
tinea cruristinea favosatinea imbricatatinea pedis
tinea pellionellatinea unguiumtinea versicolortinean
tinedtineidtineid mothtineidae
tinemantinementineoidtineoid moth
tineoideatineolatineola bisselliellatinet
tinewald, thetinfoiltinfoil hattinfoiler
tinfultingtingetinged
tingeingtingenttingertingible
tingidtingidaetingistingle
tingledtinglinesstinglingtinglingly
tinglishtinglytingztinhorn
tinidazoletinieblastiniestiniest
tininesstinja, tunisiatinktinker
tinker squaretinker to evans to …tinker to evers to …tinker's dam
tinker's damntinker's roottinker, tailortinkerbell
tinkerbell programtinkerbirdtinkeredtinkerer
tinkeringtinkerlytinkers cusstinkers damn
tinkershiretinkertoytinkletinkled
tinklertinklingtinklinglytinkly
tinlctinleytinliketinman
tinmentinmouthtinntinne
tinnedtinned dogtinned goodstinned meat
tinnentinnertinnevellitinnevelly senna
tinnietinnienttinnilytinniness
tinningtinnitustinnitus, telephonetinnock
tinnytinotinostinospora
tinpottinseltinsel cinematinseled
tinselingtinselledtinsellingtinselly
tinseltowntinselvisiontinsleyitetinsmith
tinsmithingtinsnipstinstonetint
tintatintabletintacktintagel
tintagel headtintamartintetinted
tintertintern abbeytinternelltinternet
tinticitetintintintinaitetinting
tintinnabulartintinnabularytintinnabulatetintinnabulation
tintinnabulatorytintinnabuloustintinnabulumtintle
tintotintometertintorettotintri
tintypetinwaretinworktinworks
tinytiny picturestiny printstiny tim
tinychattinycircuitstinycotinyness
tinypasstinzenitetiogatioga energy
tioga pharmaceutica…tioguaninetiotropiumtiotropium bromide
tioxolonetiptip credittip imaging
tip intip of the hattip of the ice cubetip of the iceberg
tip offtip ones handtip ones hattip or skip
tip outtip overtip sheettip table
tip the cantip the scaletip the scalestip the scales at
tip trucktip wage credittip-and-runtip-off
tip-tiltedtip-toptip-top tabletip-up
tipatipbittipcarttipcat
tipcitytipitipifarnibtipjoy
tipletipler cylindertiplesstipoff
tipp-extippecanoetippedtippee
tippertipper lorrytipper trucktipperary
tippettippextippingtipping bucket
tipping it downtipping pointtippity runstipple
tippledtipplertipplingtippling-house
tippotippoo saibtipprtippy
tippytoetipranavirtipranavir disodiumtiprosilant
tipstipsheettipsifytipsily
tipsinesstipstafftipstertipsy
tipsy caketiptaptiptoetiptoe around
tiptoertiptoestiptontiptop
tiptopitetiputipu treetipuana
tipulatipulaetipularytipulas
tipulidtipulidaetiqiqtiqueur
tirtira, israeltiraboschi, girolamotiracizine
tiradetiraditotiragalloitetirailleur
tiramisutirantiranëtirana
tiranantirandotiraniatirano
tirastiraspoltiratricoltire
tire barriertire beadtire chainstire gauge
tire irontire oftire outtire tool
tire-pressuretire-pressure gaugetire-womantire-women
tiredtired and emotionaltired irontired of
tiredlytirednesstirelesstirelessly
tirelessnesstireliketirelingtiremaker
tiresiastiresometiresomelytiresomeness
tirich mirtiringtiring-housetiring-room
tiringlytirmatirma peopletirnavos
tirnovatirotiro de graciatirol
tironiantirpitztirralirratirrit
tirsotirso de molinatirthankaratirucallane
tiruchirapallitiruchirappallitirwittiryns
tirzahtistisanetisar
tischendorf, consta…tischendorfitetisemetish
tishatisha b'abtisha b'avtishah b'ab
tishah b'avtishreitishritisic
tisicaltisickytisinalitetisiphone
tisritisserandtissuetissue adhesions
tissue adhesivestissue and organ ha…tissue and organ pr…tissue array analys…
tissue banktissue bankstissue conditioning…tissue culture
tissue culture tech…tissue distributiontissue donorstissue embedding
tissue engineeringtissue expansiontissue expansion de…tissue extracts
tissue fixationtissue genesistissue inhibitor of…tissue inhibitor of…
tissue inhibitor of…tissue inhibitor of…tissue inhibitor of…tissue kallikreins
tissue layertissue papertissue plasminogen …tissue polypeptide …
tissue preservationtissue regeneration…tissue scaffoldstissue survival
tissue therapytissue transplantat…tissue typingtissued
tissuelesstissueliketissuestissuetech
tissueytissuingtissulartissy
tiswastiszatittit for tat
tit fucktit juicetit wanktit-tat-toe
tit.titatitantitan arum
titan gamingtitanatetitanesstitania
titaniantitanictitanic acidtitanic oxide
titanicallytitanidestitaniferoustitanio
titanioustitanismtitanitetitanitic
titaniumtitanium alloytitanium aluminidetitanium boride
titanium carbidetitanium diboridetitanium dioxidetitanium hydride
titanium nitridetitanium oxidetitanium sandtitanium sponge
titanium suboxidetitanium trioxidetitanium whitetitanium(iii) oxide
titanium-46titanium-47titanium-48titanium-49
titanium-50titanotitano-titanoan
titanocenetitanomagnetitetitanosaurtitanosaurian
titanosauridaetitanosaurustitanosilicatetitanothere
titanotheriumtitanoustitanowodginitetitans
titansantitantaramellitetitanyltitbit
titchtitchfieldtitchytite
titeltitertitfertith
tithabletithetithe barntithed
tithertithingtithingmantithingmen
tithlytithoniatithonictithonicity
tithonographictithonometertithonustithymal
titititi familytiti monkeytitian
titian, vecelliotitianesquetiticacatiticaca frog
titiens, teresatitillatetitillatedtitillating
titillatinglytitillationtitillativetitin
titipounamutitivatetitivationtitlark
titletitle 21, title bartitle block
title casetitle charactertitle deedtitle defect
title of respecttitle pagetitle policytitle role
title tracktitle-holdertitle-pagetitled
titleholdertitlelesstitlertitles
titlesstitlingtitlisttitlo
titmaltitmantitmarsh, michael a…titmice
titmousetitotito, basilicatatitograd
titoismtitranttitratabletitrate
titratedtitratingtitrationtitrator
titretitrimetrictitrimetrytits
tits on a keyboardtits uptits-uptitted
tittertitter-tottertitteredtitterel
titterertitteringtitteringlytittimouse
tittingtittivatetittivationtittle
tittle-tattletittle-tattlingtittlebattittling
tittuptittytitty twistertitubant
titubatetitubationtitulartitular see
titulariestitularitytitularlytitulary
tituledtitustitus flavius domit…titus flavius sabin…
titus flavius vespa…titus liviustitus lucretius car…titus maccius plaut…
titus oatestitus vespasianus a…titus, flavius vesp…titusville
titwanktityratityustiu
tivanitetivertivitytivix
tivlitivotivoizationtivoli
tivorsan pharmaceut…tivytixtixie
tiyintiyntiztiza
tizanidinetiziano vecelliotiziotizona
tizor systemstizratizztizzy
ti\u00f3 de nadal   

The Web's Largest Resource for

Definitions & Translations


A Member Of The STANDS4 Network