Found 1,718 definitions starting with TI:

titi plantti plasmidtia
tia mariatiaa, wife of sety …tiabendazoletiadenol
tiamattiamulintiantian shan
tian-shantiana, sardiniatiananmentiananmen square
tianeptinetianjintianjin preserved v…tiapride
tiaprofenic acidtiartiaratiaraed
tiaraliketiaretiarellatiarella cordifolia
tiarella unifoliatatiazofurintib-cattibbie
tibertiberiantiberiastiberius
tiberius claudius d…tiberius claudius n…tibersofttibert, sir
tibettibet autonomous re…tibetantibetan alphabet
tibetan antelopetibetan buddhismtibetan foodtibetan fox
tibetan mastifftibetan sand foxtibetan scripttibetan spaniel
tibetan terriertibeto-tibeto-burmantibeto-burman langu…
tibeto-burman langu…tibiatibia valgatibia vara
tibiaetibialtibial arteriestibial nerve
tibial neuropathytibial veintibialetibialia
tibialistibialis anteriortibialis anticustibialis muscle
tibialis posteriortibialis posticustibicentibicinate
tibiiformtibio-tibiofemoraltibion bionic techn…
tibiotarsaltibiotarsitibiotarsustibni
tibolonetibouchinatibrietibullus
tibullus, albiustiburtiburcio carías an…tiburon
tictic disorderstic douloureuxtic tac
tic tac toetic-tactic-tac-toetical
ticarcillinticeticementtich
tichborneticheltichotichodroma
tichodroma muriariatichodrometichorrhineticilimumab
ticinoticktick (someone) offtick away
tick boxtick controltick downtick fever
tick infestationstick list featurestick marktick off
tick overtick paralysistick tocktick toxicoses
tick trefoiltick! tack!tick-borne diseasestick-borne encephal…
tick-tack-toetick-tocktick-weedtickable
tickbornetickedticked offtickell, thomas
tickentickengotickerticker tape
ticker tape paradeticker-tape paradeticketticket agent
ticket bookticket boothticket caketicket collector
ticket evolutionticket holderticket inspectorticket line
ticket officeticket stubticket takerticket tout
ticket windowticket-collectorticket-holderticket-of-leave
ticketbiscuitticketedticketflyticketing
ticketleapticketlessticketlessnessticketmaster
ticketsticketsnowticketstumblertickety&hyph;boo
tickety-bootickeytickingticking bomb
ticking-offticking-overtickletickle a bug
tickle pinktickle somebodys fu…tickle someones fan…tickle the ivories
tickle-footedtickle.comtickledtickled pink
ticklenburgticklenessticklertickler coil
tickler fileticklingticklinglyticklish
ticklishlyticklishnessticklyticknor, george
tickpicktickstickseedtickseed sunflower
ticktackticktacktoeticktacktooticktock
tickweedtickyticky tackyticky-tacky
ticlatoneticlopidineticonderogaticpolonga
ticrynafenticstictactid
tidaltidal basintidal boretidal current
tidal energytidal flattidal flowtidal force
tidal islandtidal lockingtidal powertidal range
tidal rivertidal streamtidal volumetidal wave
tidal wavestidal zonetidalitetidally
tidally lockedtidalwave tradertidbittidde
tiddertiddletiddledtiddledy winks
tiddlertiddleytiddlytiddlywink
tiddlywinkstidetide daytide dial
tide gatetide gaugetide locktide mill
tide overtide riptide tabletide waiter
tide wheeltide-rodetidedtideland
tideland signal cor…tidelesstidelessnesstidelike
tidelinetidemarktideovertidepool
tidesmantidesmentidewaitertidewater
tidewater rivertidewater streamtidewaytidewrack
tidgytidiedtidiertidies
tidifetidilytidinesstiding
tidingstidleytidley winkstidology
tidytidy sumtidy tipstidy up
tidy whitiestidy-uptidyingtidytips
tietie (someone) downtie backtie beam
tie clasptie cliptie downtie down diagram
tie down pointtie down point patt…tie dyetie in
tie in withtie in/uptie one ontie rack
tie rodtie someones handstie tacktie the knot
tie uptie up loose endstie wraptie-dye
tie-dyeingtie-intie-ontie-rod
tie-uptiebacktieback walltiebar
tiebeamtiebreaktiebreakertiebreaking
tieck, ludwigtiedtied housetied up
tiefertieflandtiefschwarztieing
tielesstiemakertiemannitetiempo
tientien shantien-paotienilic acid
tiens biotech grouptienshanitetientotientsin
tiepintiepolotiertier 1 performance
tier 3tier uptiercetierce de picardie
tierce-majortiercedtierceltiercelet
tiercettierc\u00e9tieredtiered seats
tiergartentierparktierratierra amarilla
tierra del fuegotierstiers étatties
tiëstotieticktiettaitetietze's syndrome
tiewigtifftiffanytiffany glass
tiffedtiffintiffingtiffish
tiffs treats holdin…tifinaghtiflistifo
tifttigtigatigatuzumab
tigecyclinetigellatigelletigemonam
tigertiger beetletiger breadtiger cat
tiger cowrietiger cubtiger economytiger kidnap
tiger lilytiger mothtiger prawntiger rattlesnake
tiger salamandertiger sharktiger snaketiger swallowtail
tiger teamtiger's eyetiger's-eyetiger's-foot
tiger-eyetiger-foottiger-footedtigerdom
tigerfishtigerhoodtigerinetigerish
tigerishlytigerishnesstigerliketigers
tigers eyetigerstripetigertexttigerwood
tiggertiggytightight
tight as a ducks ar…tight as a ticktight bindingtight end
tight fittight fivetight junctiontight junctions
tight lipstight looptight moneytight ship
tight spottight-fistedtight-fittingtight-knit
tight-lacedtight-lippedtight-lippednesstightass
tightdbtightentighten one's belttighten ones belt
tighten the purse s…tighten uptightenedtightener
tighteningtightertightfistedtightfistedness
tightheadtightie-whitiestightishtightlacer
tightlacingtightlippedtightlippednesstightly
tightly fittingtightly knittightnesstightrope
tightrope walkertightrope walkingtightstightwad
tightwaditytighty whitiestiglath-pileser iiitiglic
tiglic acidtiglontignontigo energy
tigogenintigontigretigrean
tigresstigrinetigrinyatigris
tigris pharmaceutic…tigris rivertigrishtijd
tijuanatiktik-toktikal
tikar peopletiketikhonenkovitetiki
tikkatikka masalatikkuntikkun leil shavuot
tikkun olamtikltikoloshetikrit
tikustiltil death do us parttil now
til treetilatilaktilapia
tilapia niloticatilasitetilawatilburg
tilburiestilburytilbury forttilda
tildetildentiletile cutter
tile rooftile sawtile trackingtile-drain
tilebasedtiledtilefishtileless
tileliketilemakertilemakingtiler
tileratileriestilerytiles
tilesettilestonetiletaminetilework
tiliatilia americanatilia cordatatilia heterophylla
tilia japonicatilia tomentosatiliaceaetiliaceous
tilidatetilidinetilingtiliomycetes
tilltillabletillagetillandsia
tillandsia usneoidestilledtilled landtiller
tiller extensiontilleredtilleringtillerman
tillettilletiatilletia cariestilletia foetida
tilletiaceaetilleytilley seedtilleyite
tillichtillietillingtillite
tillmantillmentillodonttillodontia
tillotson, john rob…tillowtillytilly, johann tserk…
tilly-vallytilmustiloronetilr
tilsittilsttilttilt angle
tilt at windmillstilt barriertilt hammertilt rail
tilt testtilt-milltilt-table testtilt-top table
tilt-uptilt-yardtiltabletilted
tiltertilthtiltingtilting board
tiltmetertiltoramatiltrotortilty
tiltyardtimtim armstrongtim leary
tim-whiskeytim.timaeustimal
timaliatimaliidaetimalinetimar
timariottimawatimbatimbal
timbaletimbale casetimbalerotimbales
timballotimbautimbe languagetimber
timber camptimber framingtimber hitchtimber line
timber raftingtimber rattlesnaketimber wolftimber yard
timber-framedtimber-raftingtimberdoodletimbered
timberheadtimberingtimberlandtimberless
timberliketimberlinetimberlingtimberman
timbermentimberworktimberyardtimbit
timbotimbraltimbretimbrel
timbreledtimbrelesstimbrelisttimbrelled
timbrictimbrotimbromaniatimbuctoo
timbuktutimbuktu labstimburinetime
time after timetime and (time) aga…time and a halftime and again
time and materialtime and motion stu…time and motion stu…time and tide
time and tide wait …time and time againtime attacktime average
time balltime beingtime belttime bill
time bombtime bomb dealstime capsuletime clock
time codetime complexitytime constanttime constraint
time cut-outstime delaytime deposittime deposit account
time differencetime dilatationtime dilationtime domain
time drafttime exposuretime factorstime flies
time flies when you…time for bedtime frametime fuze
time heals all woun…time horizontime immemorialtime interval
time istime is moneytime is of the esse…time killer
time lagtime lapsetime limittime line
time loantime locktime machinetime management
time notetime of arrivaltime of attacktime of day
time of departuretime of flighttime of lifetime of origin
time of pitchtime of the monthtime of yeartime off
time on targettime outtime out of mindtime perception
time periodtime plantime preferencetime reversal
time scaletime seriestime servedtime server
time sharetime sharingtime sheettime shifting
time signaltime signaturetime sinktime slice
time slottime spreadtime standardtime stream
time studytime ttime testtime to cater
time to cometime to killtime to markettime to target
time to timetime traveltime trialtime trialist
time tunneltime unittime valuetime value of money
time warptime zonetime-and-motion stu…time-ball
time-consumingtime-definite deliv…time-delay measurin…time-delay measurin…
time-dependenttime-falltime-fusetime-honored
time-honouredtime-independenttime-invarianttime-lag
time-lapsetime-lapse photogra…time-limittime-line
time-motion studytime-of-flighttime-of-flight mass…time-out
time-phased force a…time-phased force a…time-phased force a…time-phased force a…
time-reactiontime-risetime-savingtime-scale factor
time-sensitive targ…time-servingtime-sharetime-sharing
time-slicingtime-space converge…time-stamptime-switch
time-tabletime-testedtime-travellertime-waster
time-weightedtime-worntimebombtimebook
timeboundtimeboxtimebridgetimecard
timecodetimecoursetimedtimed out
timed texttimed-releasetimefultimehop
timekeepertimekeeperstimekeepingtimelab
timelapsetimelesstimeless existencetimelessly
timelessnesstimeliketimelikenesstimelily
timelinetimelinestimelinesstimeling
timelordtimelytimenoguytimeoff
timeoustimeouslytimeouttimepass
timepiecetimepleasertimepointtimeproof
timertimestimes or divided bytimes sign
times squaretimes tabletimesavertimesaving
timescapetimesetimeservertimeserving
timesharetimeshare broker sa…timesharingtimesheet
timesight systemstimesliptimeslottimespan
timestamptimesteptimestreamtimetable
timetrade systemstimewarptimewastingtimewave
timeweightedtimewisetimeworktimeworn
timexchangetimezonetimgadtimi
timişoaratimidtimiditytimidity++
timidlytimidnesstimidoustimimoun
timingtiming belttiming is everythingtimiskaming
timisoaratimisttimi\u015foaratimmer
timminstimmotimmytimnodonic
timnodonic acidtimocracytimocratictimoleon
timololtimontimon of phliustimoneer
timonismtimonisttimonizationtimonize
timophiliatimortimor seatimor-leste
timoresetimoroustimorouslytimorousness
timorsometimotheustimothytimothy francis lea…
timothy grasstimothy learytimothy miles bindo…timous
timpanitimpanisttimpanotimpanum
timpletimucutimucuatimur
timur lenktimur the tartartimzontin
tin a metal; one of…tin boxtin cantin compounds
tin crytin cuptin diseasetin dog
tin eartin fluoridestin foiltin foil hat
tin godtin hattin knockertin lizzie
tin mantin mentin openertin pan alley
tin parachutetin pesttin plaguetin plate
tin polyphosphatestin pyritestin radioisotopestin sandwich
tin soldiertin sounderstin tabernacletin whistle
tin yin leuntin(ii) fluoridetin-foil hattin-opener
tin-platetin-platingtin-pottin-pot dictator
tinatinajatinajastinaksite
tinamidaetinamidestinamiformestinamou
tinbergentinctincatinca tinca
tincaltincalconitetincheltinclad
tincttinct.tinctorialtinctura
tincturationtincturetincture of iodinetincture of opium
tincturedtincturingtindtindal
tindal, matthewtindaletindalltinder
tinderboxtinderytindietindora
tindyebwa agaba wisetinetine testtinea
tinea barbaetinea capitistinea corporistinea cruris
tinea favosatinea imbricatatinea pedistinea pellionella
tinea unguiumtinea versicolortineantined
tineidtineid mothtineidaetineman
tinementineoidtineoid mothtineoidea
tineolatineola bisselliellatinettinewald, the
tinfoiltinfoil hattinfoilertinful
tingtingetingedtingeing
tingenttingertingibletingid
tingidaetingistingletingled
tinglinesstinglingtinglinglytinglish
tinglytingztinhorntinidazole
tinieblastiniestiniesttininess
tinja, tunisiatinktinkertinker square
tinker to evans to …tinker to evers to …tinker's damtinker's damn
tinker's roottinker, tailortinkerbelltinkerbell program
tinkerbirdtinkeredtinkerertinkering
tinkerlytinkers cusstinkers damntinkershire
tinkertoytinkletinkledtinkler
tinklingtinklinglytinklytinlc
tinleytinliketinmantinmen
tinmouthtinntinnetinned
tinned dogtinned goodstinned meattinnen
tinnertinnevellitinnevelly sennatinnie
tinnienttinnilytinninesstinning
tinnitustinnitus, telephonetinnocktinny
tinotinostinosporatinpot
tinseltinsel cinematinseledtinseling
tinselledtinsellingtinsellytinseltown
tinselvisiontinsleyitetinsmithtinsmithing
tinsnipstinstonetinttinta
tintabletintacktintageltintagel head
tintamartintetintedtinter
tintern abbeytinternelltinternettinticite
tintintintinaitetintingtintinnabular
tintinnabularytintinnabulatetintinnabulationtintinnabulatory
tintinnabuloustintinnabulumtintletinto
tintometertintorettotintritintype
tinwaretinworktinworkstiny
tiny picturestiny printstiny timtinychat
tinycircuitstinycotinynesstinypass
tinzenitetiogatioga energytioga pharmaceutica…
tioguaninetiotropiumtiotropium bromidetioxolone
tiptip credittip imagingtip in
tip of the hattip of the ice cubetip of the icebergtip off
tip ones handtip ones hattip or skiptip out
tip overtip sheettip tabletip the can
tip the scaletip the scalestip the scales attip truck
tip wage credittip-and-runtip-offtip-tilted
tip-toptip-top tabletip-uptipa
tipbittipcarttipcattipcity
tipitipifarnibtipjoytiple
tipler cylindertiplesstipofftipp-ex
tippecanoetippedtippeetipper
tipper lorrytipper trucktipperarytippet
tippextippingtipping buckettipping it down
tipping pointtippity runstippletippled
tipplertipplingtippling-housetippo
tippoo saibtipprtippytippytoe
tipranavirtipranavir disodiumtiprosilanttips
tipsheettipsifytipsilytipsiness
tipstafftipstertipsytipsy cake
tiptaptiptoetiptoe aroundtiptoer
tiptoestiptontiptoptiptopite
tiputipu treetipuanatipula
tipulaetipularytipulastipulid
tipulidaetiqiqtiqueurtir
tira, israeltiraboschi, girolamotiracizinetirade
tiraditotiragalloitetirailleurtiramisu
tirantiranëtiranatiranan
tiraniatiranotirastiraspol
tiratricoltiretire barriertire bead
tire chainstire gaugetire irontire of
tire outtire tooltire-pressuretire-pressure gauge
tire-womantire-womentiredtired and emotional
tired irontired oftiredlytiredness
tirelesstirelesslytirelessnesstirelike
tirelingtiremakertiresiastiresome
tiresomelytiresomenesstirich mirtiring
tiring-housetiring-roomtiringlytirma
tirma peopletirnavostirnovatiro
tiro de graciatiroltironiantirpitz
tirralirratirrittirsotirso de molina
tirthankaratirucallanetiruchirapallitiruchirappalli
tirwittirynstirzahtis
tisanetisartischendorf, consta…tischendorfite
tisemetishtishatisha b'ab
tisha b'avtishah b'abtishah b'avtishrei
tishritisictisicaltisicky
tisinalitetisiphonetisritisserand
tissuetissue adhesionstissue adhesivestissue and organ ha…
tissue and organ pr…tissue array analys…tissue banktissue banks
tissue conditioning…tissue culturetissue culture tech…tissue distribution
tissue donorstissue embeddingtissue engineeringtissue expansion
tissue expansion de…tissue extractstissue fixationtissue genesis
tissue inhibitor of…tissue inhibitor of…tissue inhibitor of…tissue inhibitor of…
tissue inhibitor of…tissue kallikreinstissue layertissue paper
tissue plasminogen …tissue polypeptide …tissue preservationtissue regeneration…
tissue scaffoldstissue survivaltissue therapytissue transplantat…
tissue typingtissuedtissuelesstissuelike
tissuestissuetechtissueytissuing
tissulartissytiswastisza
tittit for tattit fucktit juice
tit wanktit-tat-toetit.titan
titan arumtitan gamingtitanatetitaness
titaniatitaniantitanictitanic acid
titanic oxidetitanicallytitanidestitaniferous
titaniotitanioustitanismtitanite
titanitictitaniumtitanium alloytitanium aluminide
titanium boridetitanium carbidetitanium diboridetitanium dioxide
titanium hydridetitanium nitridetitanium oxidetitanium sand
titanium spongetitanium suboxidetitanium trioxidetitanium white
titanium(iii) oxidetitanium-46titanium-47titanium-48
titanium-49titanium-50titanotitano-
titanoantitanocenetitanomagnetitetitanosaur
titanosauriantitanosauridaetitanosaurustitanosilicate
titanotheretitanotheriumtitanoustitanowodginite
titanstitansantitantaramellitetitanyl
titbittitchtitchfieldtitchy
titetiteltitertitfer
tithtithabletithetithe barn
tithedtithertithingtithingman
tithingmentithlytithoniatithonic
tithonicitytithonographictithonometertithonus
tithymaltitititi familytiti monkey
titiantitian, vecelliotitianesquetiticaca
titicaca frogtitiens, teresatitillatetitillated
titillatingtitillatinglytitillationtitillative
titintitipounamutitivatetitivation
titlarktitletitle 21, title bar
title blocktitle casetitle charactertitle deed
title defecttitle of respecttitle pagetitle policy
title roletitle tracktitle-holdertitle-page
titledtitleholdertitlelesstitler
titlestitlesstitlingtitlist
titlotitmaltitmantitmarsh, michael a…
titmicetitmousetitotito, basilicata
titogradtitoismtitranttitratable
titratetitratedtitratingtitration
titratortitretitrimetrictitrimetry
titstits on a keyboardtits uptits-up
tittedtittertitter-tottertittered
tittereltitterertitteringtitteringly
tittimousetittingtittivatetittivation
tittletittle-tattletittle-tattlingtittlebat
tittlingtittuptittytitty twister
titubanttitubatetitubationtitular
titular seetitulariestitularitytitularly
titularytituledtitustitus flavius domit…
titus flavius sabin…titus flavius vespa…titus liviustitus lucretius car…
titus maccius plaut…titus oatestitus vespasianus a…titus, flavius vesp…
titusvilletitwanktityratityus
tiutivanitetivertivity
tivixtivlitivotivoization
tivolitivorsan pharmaceut…tivytix
tixietiyintiyntiz
tizatizanidinetiziano vecelliotizio
tizonatizor systemstizratizz
tizzyti\u00f3 de nadal  

The Web's Largest Resource for

Definitions & Translations


A Member Of The STANDS4 Network