Found 1,742 definitions starting with TI:

titi plantti plasmidtia
tia mariatiaa, wife of seti …tiaa, wife of sety …tiabendazole
tiadenoltiamattiamulintian
tian shantian-shantiana, sardiniatiananmen
tiananmen squaretianeptinetianjintianjin preserved v…
tiapridetiaprofenic acidtiartiara
tiaraedtiaraliketiaretiarella
tiarella cordifoliatiarella unifoliatatiazofurintib-cat
tibbietibea languagetibertiberian
tiberiastiberiustiberius claudius d…tiberius claudius n…
tibersofttibert, sirtibettibet autonomous re…
tibetantibetan alphabettibetan antelopetibetan buddhism
tibetan foodtibetan foxtibetan mastifftibetan sand fox
tibetan scripttibetan spanieltibetan terriertibeto-
tibeto-burmantibeto-burman langu…tibeto-burman langu…tibia
tibia valgatibia varatibiaetibial
tibial arteriestibial nervetibial neuropathytibial vein
tibialetibialiatibialistibialis anterior
tibialis anticustibialis muscletibialis posteriortibialis posticus
tibicentibicinatetibiiformtibio-
tibiofemoraltibion bionic techn…tibiotarsaltibiotarsi
tibiotarsustibnitibolonetibor
tibouchinatibrietibullustibullus, albius
tiburtiburcio carías an…tiburontic
tic disorderstic douloureuxtic tactic tac toe
tic-tactic-tac-toeticalticarcillin
ticeticementtichtichborne
ticheltichotichodromatichodroma muriaria
tichodrometichorrhineticilimumabticino
ticktick (someone) offtick awaytick box
tick controltick downtick fevertick infestations
tick list featurestick marktick offtick over
tick paralysistick tocktick toxicosestick trefoil
tick! tack!tick-borne diseasestick-borne encephal…tick-tack-toe
tick-tocktick-weedtickabletickborne
tickedticked offtickell, thomasticken
tickengotickerticker symbolticker tape
ticker tape paradeticker-tape paradeticketticket agent
ticket bookticket boothticket caketicket collector
ticket evolutionticket holderticket inspectorticket line
ticket officeticket stubticket takerticket tout
ticket windowticket-collectorticket-holderticket-of-leave
ticketbiscuitticketedticketflyticketing
ticketleapticketlessticketlessnessticketmaster
ticketsticketsnowticketstumblertickety&hyph;boo
tickety-bootickeytickingticking bomb
ticking-offticking-overtickletickle a bug
tickle pinktickle somebodys fu…tickle someones fan…tickle the ivories
tickle-footedtickle.comtickledtickled pink
ticklenburgticklenessticklertickler coil
tickler fileticklingticklinglyticklish
ticklishlyticklishnessticklyticknor, george
tickpicktickstickseedtickseed sunflower
ticktackticktacktoeticktacktooticktock
tickweedtickyticky tackyticky-tacky
ticlatoneticlopidineticoticonderoga
ticpolongaticrynafenticstictac
tidtidaltidal basintidal bore
tidal currenttidal energytidal flattidal flow
tidal forcetidal islandtidal lockingtidal power
tidal rangetidal rivertidal streamtidal volume
tidal wavetidal wavestidal zonetidalite
tidallytidally lockedtidalwave tradertidbit
tidbitstiddetiddertiddle
tiddledtiddledy winkstiddlertiddley
tiddlytiddlywinktiddlywinkstide
tide daytide dialtide gatetide gauge
tide locktide milltide overtide rip
tide tabletide waitertide wheeltide-rode
tidedtidelandtideland signal cor…tideless
tidelessnesstideliketidelinetidemark
tideovertidepooltidesmantidesmen
tidewaitertidewatertidewater rivertidewater stream
tidewaytidewracktidgytidied
tidiertidiestidifetidily
tidinesstidingtidingstidley
tidley winkstidologytidytidy sum
tidy tipstidy uptidy whitiestidy-up
tidyingtidytipstietie (someone) down
tie backtie beamtie clasptie clip
tie downtie down diagramtie down pointtie down point patt…
tie dyetie intie in withtie in/up
tie one ontie racktie rodtie someones hands
tie tacktie the knottie uptie up loose ends
tie wraptie-dyetie-dyeingtie-in
tie-ontie-rodtie-uptieback
tieback walltiebartiebeamtiebreak
tiebreakertiebreakingtieck, ludwigtied
tied housetied uptiefertiefland
tiefschwarztieingtielesstiemaker
tiemannitetiempotientien shan
tien-paotiene languagetienentienilic acid
tiens biotech grouptienshanitetientotientsin
tiepintiepolotiertier 1 performance
tier 3tier uptiercetierce de picardie
tierce-majortiercedtierceltiercelet
tiercettierc\u00e9tieredtiered seats
tiergartentierparktierratierra amarilla
tierra calientetierra del fuegotierstiers état
tiestiëstotieticktiettaite
tietze's syndrometiewigtiferettiff
tiffanytiffany glasstiffedtiffin
tiffingtiffishtiffs treats holdin…tifinagh
tiflistifotifttig
tigatigatuzumabtigecyclinetigella
tigelletigemonamtigertiger beetle
tiger breadtiger cattiger cowrietiger cub
tiger economytiger kidnaptiger lilytiger moth
tiger prawntiger rattlesnaketiger salamandertiger shark
tiger snaketiger swallowtailtiger teamtiger's eye
tiger's-eyetiger's-foottiger-eyetiger-foot
tiger-footedtigerdomtigerfishtigerhood
tigerinetigerishtigerishlytigerishness
tigerliketigerstigers eyetigerstripe
tigertexttigerwoodtiggertiggy
tightighttight as a ducks ar…tight as a tick
tight bindingtight endtight fittight five
tight junctiontight junctionstight lipstight loop
tight moneytight shiptight spottight-fisted
tight-fittingtight-knittight-lacedtight-lipped
tight-lippednesstightasstightdbtighten
tighten one's belttighten ones belttighten the purse s…tighten up
tightenedtightenertighteningtighter
tightfistedtightfistednesstightheadtightie-whities
tightishtightlacertightlacingtightlipped
tightlippednesstightlytightly fittingtightly knit
tightnesstightropetightrope walkertightrope walking
tightstightwadtightwaditytighty whities
tiglath-pileser iiitiglictiglic acidtiglon
tignontigo energytigogenintigon
tigretigreantigresstigrine
tigrinyatigristigris pharmaceutic…tigris river
tigrishtijdtijuanatik
tik-toktikaltikar peopletike
tikhonenkovitetikitikitikitikka
tikka masalatikkuntikkun leil shavuottikkun olam
tikltikoloshetikrittikus
tiltil death do us parttil nowtil tree
tilatilaktilapiatilapia nilotica
tilasitetilawatilburgtilburies
tilburytilbury forttildatilde
tildentiletile cuttertile roof
tile sawtile trackingtile-draintilebased
tiledtilefishtilelesstilelike
tilemakertilemakingtilertilera
tileriestilerytilestileset
tilestonetiletaminetileworktilford
tiliatilia americanatilia cordatatilia heterophylla
tilia japonicatilia tomentosatiliaceaetiliaceous
tilidatetilidinetilingtiliomycetes
tilltill thentillabletillage
tillandsiatillandsia usneoidestilledtilled land
tillertiller extensiontilleredtillering
tillermantillettilletiatilletia caries
tilletia foetidatilletiaceaetilleytilley seed
tilleyitetillichtillietilling
tillitetilllatetillmantillmen
tillodonttillodontiatillotson, john rob…tillow
tillytilly, johann tserk…tilly-vallytilmus
tiloronetilrtilsittilst
tilttilt angletilt at windmillstilt barrier
tilt hammertilt railtilt testtilt-mill
tilt-table testtilt-top tabletilt-uptilt-yard
tiltabletiltedtiltertilth
tiltingtilting boardtiltmetertiltorama
tiltrotortiltytiltyardtim
tim armstrongtim learytim marshalltim-whiskey
tim.timaeustimaltimalia
timaliidaetimalinetimartimariot
timawatimbatimbaltimbale
timbale casetimbalerotimbalestimballo
timbautimbe languagetimbertimber camp
timber culture acttimber framingtimber hitchtimber line
timber raftingtimber rattlesnaketimber wolftimber yard
timber-framedtimber-raftingtimberdoodletimbered
timberheadtimberingtimberlaketimberland
timberlesstimberliketimberlinetimberling
timbermantimbermentimberworktimberyard
timbittimbotimbraltimbre
timbreltimbreledtimbrelesstimbrelist
timbrelledtimbrictimbrotimbromania
timbuctootimbuktutimbuktu labstimburine
timetime after timetime and (time) aga…time and a half
time and againtime and materialtime and motion stu…time and motion stu…
time and tidetime and tide wait …time and time againtime attack
time averagetime balltime beingtime belt
time billtime bombtime bomb dealstime bombs
time capsuletime clocktime codetime complexity
time constanttime constrainttime cut-outstime delay
time deposittime deposit accounttime differencetime dilatation
time dilationtime domaintime drafttime exposure
time factorstime fliestime flies when you…time for bed
time frametime fuzetime heals all woun…time horizon
time immemorialtime intervaltime istime is money
time is of the esse…time is running outtime killertime lag
time lapsetime limittime linetime loan
time locktime machinetime managementtime note
time of arrivaltime of attacktime of daytime of departure
time of flighttime of lifetime of origintime of pitch
time of the monthtime of yeartime offtime on target
time outtime out of mindtime perceptiontime period
time plantime preferencetime reversaltime scale
time seriestime servedtime servertime share
time sharingtime sheettime shiftingtime signal
time signaturetime sinktime slicetime slot
time spreadtime standardtime stands stilltime stream
time studytime ttime testtime to cater
time to cometime to killtime to markettime to target
time to timetime traveltime trialtime trialist
time tunneltime unittime valuetime value of money
time warptime zonetime-and-motion stu…time-ball
time-consumingtime-definite deliv…time-delay measurin…time-delay measurin…
time-dependenttime-falltime-fusetime-honored
time-honouredtime-independenttime-invarianttime-lag
time-lapsetime-lapse photogra…time-limittime-line
time-motion studytime-of-flighttime-of-flight mass…time-out
time-phased force a…time-phased force a…time-phased force a…time-phased force a…
time-reactiontime-risetime-savingtime-scale factor
time-sensitive targ…time-servingtime-sharetime-sharing
time-slicingtime-space converge…time-stamptime-switch
time-tabletime-testedtime-travellertime-waster
time-weightedtime-worntimebombtimebook
timeboundtimeboxtimebridgetimecard
timecodetimecoursetimedtimed out
timed texttimed-releasetimefultimehop
timekeepertimekeeperstimekeepingtimelab
timelapsetimelesstimeless existencetimelessly
timelessnesstimeliketimelikenesstimelily
timelinetimelinestimelinesstimeling
timelordtimelytimenoguytimeoff
timeoustimeouslytimeouttimepass
timepiecetimepleasertimepointtimeproof
timertimestimes or divided bytimes sign
times squaretimes tabletimesavertimesaving
timescapetimesetimeservertimeserving
timesharetimeshare broker sa…timesharingtimesheet
timesight systemstimesliptimeslottimespan
timestamptimesteptimestreamtimetable
timetrade systemstimewarptimewastingtimewave
timeweightedtimewisetimeworktimeworn
timexchangetimezonetime–space compre…timgad
timitimişoaratimidtimidity
timidity++timidlytimidnesstimidous
timimountimingtiming belttiming is everything
timiskamingtimisoaratimisttimi\u015foara
timmertimminstimmotimmy
timnodonictimnodonic acidtimocracytimocratic
timoleontimololtimontimon of phlius
timoneertimonismtimonisttimonization
timonizetimophiliatimortimor sea
timor-lestetimoresetimoroustimorously
timorousnesstimorsometimotheustimothy
timothy francis lea…timothy grasstimothy learytimothy miles bindo…
timoustimpanitimpanisttimpano
timpanumtimpletimucutimucua
timurtimur lenktimur the tartartimzon
tintin a metal; one of…tin boxtin can
tin compoundstin crytin cuptin disease
tin dogtin eartin fluoridestin foil
tin foil hattin godtin hattin knocker
tin lizzietin mantin mentin opener
tin pan alleytin parachutetin pesttin plague
tin platetin polyphosphatestin pyritestin radioisotopes
tin sandwichtin soldiertin sounderstin tabernacle
tin whistletin yin leuntin(ii) fluoridetin-foil hat
tin-openertin-platetin-platingtin-pot
tin-pot dictatortinatina modottitinaja
tinajastinaksitetinamidaetinamides
tinamiformestinamoutinbergentinc
tincatinca tincatincaltincalconite
tincheltincladtincttinct.
tinctorialtincturatincturationtincture
tincture of iodinetincture of opiumtincturedtincturing
tindtindaltindal, matthewtindale
tindalltindertinderboxtindery
tindietindoratindyebwa agaba wisetine
tine testtineatinea barbaetinea capitis
tinea corporistinea cruristinea favosatinea imbricata
tinea pedistinea pellionellatinea unguiumtinea versicolor
tineantinedtineidtineid moth
tineidaetinemantinementineoid
tineoid mothtineoideatineolatineola bisselliella
tinettinewald, thetinfoiltinfoil hat
tinfoilertinfultingtinge
tingedtingeingtingenttinger
tingibletingidtingidaetingis
tingletingledtinglinesstingling
tinglinglytinglishtinglytingz
tinhorntinidazoletinieblastinies
tiniesttininesstinja, tunisiatink
tinkertinker squaretinker to evans to …tinker to evers to …
tinker's damtinker's damntinker's roottinker, tailor
tinkerbelltinkerbell programtinkerbirdtinkered
tinkerertinkeringtinkerlytinkers cuss
tinkers damntinkershiretinkertoytinkle
tinkledtinklertinklingtinklingly
tinklytinlctinleytinlike
tinmantinmentinmouthtinn
tinnetinnedtinned dogtinned goods
tinned meattinnentinnertinnevelli
tinnevelly sennatinnietinnienttinnily
tinninesstinningtinnitustinnitus, telephone
tinnocktinnytinotinos
tinosporatinpottinseltinsel cinema
tinseledtinselingtinselledtinselling
tinsellytinseltowntinselvisiontinsleyite
tinsmithtinsmithingtinsnipstinstone
tinttintatintabletintack
tintageltintagel headtintamartinte
tintedtintertintern abbeytinternell
tinternettinticitetintintintinaite
tintingtintinnabulartintinnabularytintinnabulate
tintinnabulationtintinnabulatorytintinnabuloustintinnabulum
tintletintotintometertintoretto
tintritintypetinwaretinwork
tinworkstinytiny picturestiny prints
tiny timtinychattinycircuitstinyco
tinynesstinypasstinzenitetioga
tioga energytioga pharmaceutica…tioguaninetiotropium
tiotropium bromidetioxolonetiptip credit
tip imagingtip intip of the hattip of the ice cube
tip of the icebergtip offtip ones handtip ones hat
tip or skiptip outtip overtip sheet
tip tabletip the cantip the scaletip the scales
tip the scales attip trucktip wage credittip-and-run
tip-offtip-tiltedtip-toptip-top table
tip-uptipatipbittipcart
tipcattipcitytipitipifarnib
tipjoytipletipler cylindertipless
tipofftipp-extippecanoetipped
tippeetippertipper lorrytipper truck
tipperarytippettippextipping
tipping buckettipping it downtipping pointtippity runs
tippletippledtipplertippling
tippling-housetippotippoo saibtippr
tippytippytoetipranavirtipranavir disodium
tiprosilanttipstipsheettipsify
tipsilytipsinesstipstafftipster
tipsytipsy caketiptaptiptoe
tiptoe aroundtiptoertiptoestipton
tiptoptiptopitetiputipu tree
tipuanatipulatipulaetipulary
tipulastipulidtipulidaetiqiq
tiqueurtirtira, israeltiraboschi, girolamo
tiracizinetiradetiraditotiragalloite
tirailleurtiramisutirantiranë
tiranatiranantirandotirania
tiranotirastiraspoltiratricol
tiretire barriertire beadtire chains
tire gaugetire irontire oftire out
tire tooltire-pressuretire-pressure gaugetire-woman
tire-womentiredtired and emotionaltired iron
tired oftiredlytirednesstireless
tirelesslytirelessnesstireliketireling
tiremakertiresiastiresometiresomely
tiresomenesstirich mirtiringtiring-house
tiring-roomtiringlytirmatirma people
tirnavostirnovatirotiro de gracia
tiroltironiantirpitztirralirra
tirrittirsotirso de molinatirthankara
tirucallanetiruchirapallitiruchirappallitirwit
tirynstirzahtistisane
tisartischendorf, consta…tischendorfitetiseme
tishtishatisha b'abtisha b'av
tishah b'abtishah b'avtishreitishri
tisictisicaltisickytisinalite
tisiphonetisritisserandtissue
tissue adhesionstissue adhesivestissue and organ ha…tissue and organ pr…
tissue array analys…tissue banktissue bankstissue conditioning…
tissue culturetissue culture tech…tissue distributiontissue donors
tissue embeddingtissue engineeringtissue expansiontissue expansion de…
tissue extractstissue fixationtissue genesistissue inhibitor of…
tissue inhibitor of…tissue inhibitor of…tissue inhibitor of…tissue inhibitor of…
tissue kallikreinstissue layertissue papertissue plasminogen …
tissue polypeptide …tissue preservationtissue regeneration…tissue scaffolds
tissue survivaltissue therapytissue transplantat…tissue typing
tissuedtissuelesstissueliketissues
tissuetechtissueytissuingtissular
tissytiswastiszatit
tit for tattit fucktit juicetit wank
tit-tat-toetit.titatitan
titan arumtitan gamingtitanatetitaness
titaniatitaniantitanictitanic acid
titanic oxidetitanicallytitanidestitaniferous
titaniotitanioustitanismtitanite
titanitictitaniumtitanium alloytitanium aluminide
titanium boridetitanium carbidetitanium diboridetitanium dioxide
titanium hydridetitanium nitridetitanium oxidetitanium sand
titanium spongetitanium suboxidetitanium trioxidetitanium white
titanium(iii) oxidetitanium-46titanium-47titanium-48
titanium-49titanium-50titanotitano-
titanoantitanocenetitanomagnetitetitanosaur
titanosauriantitanosauridaetitanosaurustitanosilicate
titanotheretitanotheriumtitanoustitanowodginite
titanstitansantitantaramellitetitanyl
titbittitchtitchfieldtitchy
titetiteltitertitfer
tithtithabletithetithe barn
tithedtithertithingtithingman
tithingmentithlytithoniatithonic
tithonicitytithonographictithonometertithonus
tithymaltitititi familytiti monkey
titiantitian, vecelliotitianesquetiticaca
titicaca frogtitiens, teresatitillatetitillated
titillatingtitillatinglytitillationtitillative
titintitipounamutitivatetitivation
titlarktitletitle 21, title bar
title blocktitle casetitle charactertitle deed
title defecttitle of respecttitle pagetitle policy
title roletitle tracktitle-holdertitle-page
titledtitleholdertitlelesstitler
titlestitlesstitlingtitlist
titlotitmaltitmantitmarsh, michael a…
titmicetitmousetitotito, basilicata
titogradtitoismtitranttitratable
titratetitratedtitratingtitration
titratortitretitrimetrictitrimetry
titstits on a keyboardtits uptits-up
tittedtittertitter-tottertittered
tittereltitterertitteringtitteringly
tittimousetittingtittivatetittivation
tittletittle-tattletittle-tattlingtittlebat
tittlingtittuptittytitty twister
titubanttitubatetitubationtitular
titular seetitulariestitularitytitularly
titularytituledtitustitus flavius domit…
titus flavius sabin…titus flavius vespa…titus liviustitus lucretius car…
titus maccius plaut…titus oatestitus vespasianus a…titus, flavius vesp…
titusvilletitwanktityratityus
tiutivanitetivertivity
tivixtivlitivotivoization
tivolitivorsan pharmaceut…tivytix
tixietiyintiyntiz
tizatizanidinetiziano vecelliotizio
tizonatizor systemstizratizz
tizzyti\u00f3 de nadal  

The Web's Largest Resource for

Definitions & Translations


A Member Of The STANDS4 Network