Found 3,145 definitions starting with CR:

crcrêpesuzettecrèchecrème
crèmedecacaocrèmedecassiscrèmedelacr&…crèmedementhe
crèmefra&ici…crèvecoeurcr.cr/che
crabcrab applecrab boilcrab burger
crab cactuscrab canoncrab cocktailcrab grass
crab legscrab louiscrab lousecrab mentality
crab nebulacrab rangooncrab spidercrab tree
crab-eatercrab-eating dogcrab-eating foxcrab-eating macaque
crab-eating opossumcrab-eating raccooncrab-eating sealcrab-plover
crab-yawscrabapplecrabapple jellycrabbe, george
crabbedcrabbedlycrabbednesscrabber
crabbilycrabbinesscrabbingcrabbish
crabbitcrabburgercrabbycrabby person
crabeatercrabeater sealcrabercrabfaced
crabgrasscrabletcrablikecrabmeat
crabronidcrabscrabsidlecrabstick
crabwisecrac!crachecracid
cracidaecrackcrack a bookcrack a crib
crack a fatcrack a smilecrack a smile... an…crack addict
crack babycrack cocainecrack downcrack down (on)
crack down oncrack ficcrack housecrack of dawn
crack of doomcrack oncrack ones fingerscrack onto
crack pipecrack rockcrack rootcrack seed
crack shotcrack throughcrack traincrack up
crack whorecrack willowcrack wisecrack-brained
crack-pipecrack-upcrackacrackable
crackbackcrackberrycrackbraincrackbrained
crackdowncrackedcracked tooth syndr…cracked wheat
cracked-wheat breadcrackednesscrackercracker bonbon
cracker boxcracker crumbscracker jackcracker jacks
cracker-barrelcrackerberrycrackerboxcrackerjack
crackerlesscrackerlikecrackerscrackhead
crackhousecrackingcracking upcrackle
crackle chinacrackle – the bes…crackleberrycrackled
cracklescracklewarecracklikecrackling
cracklinglycracklingscracklinscrackly
cracknelcrackowcrackpipecrackpot
crackpotterycrackproofcrackscracksman
cracksmencracktivismcracktrocrackup
crackwhorecrackycracky wagoncracovian
cracoviennecracowcracowescracticidae
cracticinaecracticuscradd signaling ada…cradgedness
cradlecradle capcradle catholiccradle mountain
cradle of civilizat…cradle robbercradle snatchercradle technologies
cradle-to-cradle de…cradle-to-gravecradleboardcradled
cradlelikecradlesongcradlingcraft
craft centrecraft faircraft unioncrafted
craftednesscraftercraftilycraftiness
craftlesscraftlikecrafts centrecraftsman
craftsmanlikecraftsmanlycraftsmanshipcraftsmaster
craftsmencraftspersoncraftspersonshipcraftswoman
craftswomanshipcraftsycraftworkcraftworker
craftycragcragfastcragged
craggednesscraggercraggilycragginess
craggycragscragsmancragsmen
craiccraiecraigcraig flounder
craig serani marshcraig ventnercraig, johncraig, sir thomas
craigenputtockcraigiecraigslistcraigslist inc.
craigslistercraigslistingcraikcraik, george little
craik, mrs.crailcraincraiova
craisincrakecrakeberrycraker
crakowcramcram downcram full
cram schoolcram sessioncram worldwidecram-full
crambecrambe maritimacrambe plantcrambe sponge
crambocrambucramdowncramer
cramer, johann bapt…cramlingtoncrammedcrammer
crammingcramoisiecramoisycramp
cramp ironcramp someones stylecrampbarkcramped
crampednesscrampetcrampfishcrampiness
crampingcrampitcramponcramponee
cramponscrampooncrampoonscramps
crampycramstercrancranach
cranach, lucascranachancranagecranapple
cranberriescranberrycranberry bushcranberry culture
cranberry heathcranberry juicecranberry morphemecranberry sauce
cranberry treecranberryingcranberrylikecrance
cranchcrandallitecranecrane fly
crane's billcrane's-billcrane, ichabodcrane, walter
crane-drivercranedcraneflycranelike
cranescranesbillcrangcrangon
crangonidaecranhamcraniacranial
cranial cavitycranial fontanellescranial fossa, ante…cranial fossa, midd…
cranial fossa, post…cranial indexcranial irradiationcranial nerve
cranial nerve disea…cranial nerve injur…cranial nerve neopl…cranial nerves
cranial orbitcranial sinusescranial suturescranially
craniatacraniatecranidiumcraniectomy
craningcraniocaudalcraniocerebral trau…cranioclasm
cranioclastcraniodentalcraniofacialcraniofacial abnorm…
craniofacial abnorm…craniofacial dysost…craniofaciallycraniognomy
craniologicalcraniologicallycraniologistcraniology
craniomandibularcraniomandibular di…craniometercraniometric
craniometric pointcraniometricalcraniometrycraniopagus
craniopharyngiomacraniosacralcranioscopistcranioscopy
craniosophiccraniosynostosescraniosynostosiscraniota
craniotomycranite systemscraniumcraniums
crankcrank anglecrank angle degreecrank call
crank handlecrank lettercrank outcrank science
crank upcrankbirdcrankcasecranked
crankilycrankinesscranklecrankness
crankpincrankscranksetcrankshaft
crankycranmercranmer, thomascrannied
cranniescrannockcrannogcrannoge
crannycrannyingcranstoncrant
crantaracrantscrapcrap artist
crap gamecrap on a stickcrap ones pantscrap out
crap shootingcrap upcrap-shootercrapaud
crapaud, jeancrapaudinecrapecrape fern
crape jasminecrape myrtlecrapedcrapefish
crapehangercrapelikecrapettecrapface
crapfestcrapfloodcrapgamecraphat
crapheadcrapholecraphousecraping
craploadcrapmobilecrapnelcrapola
crappercrappiecrappilycrappiness
crappitycrapplecrappletcrappo
crappycrapscrapshootcrapshooter
crapstormcraptacularcraptasticcraptastical
craptexcrapulacrapulecrapulence
crapulentcrapulentallcrapulouscrapulously
crapulousnesscrapwarecrapycraquelure
crarecrascrasecrash
crash and burncrash barriercrash boxcrash cart
crash coursecrash cymbalcrash dietcrash dive
crash gearboxcrash helmetcrash hotcrash land
crash landingcrash locator beaconcrash outcrash pad
crash position indi…crash programcrash programmecrash rescue and fi…
crash spacecrash testcrash test dummycrash trolley
crash-divecrash-helmetcrash-landcrashable
crashawcrashaw, richardcrashdumpcrashed
crashercrashingcrashinglycrashless
crashlikecrashlyticscrashpadcrashproof
crashworthinesscrashworthycrashycrasis
craspediacraspedotacraspedotecrass
crassamentcrassamentumcrassimentcrassitude
crasslycrassnesscrassostreacrassula
crassula ovatacrassulaceaecrassulaceancrassus
crassus, lucius lic…crassus, marcus lic…crastinationcrat
crataeguscrataegus aestivaliscrataegus apiifoliacrataegus biltmorea…
crataegus calpodend…crataegus coccineacrataegus coccinea …crataegus crus-galli
crataegus laevigatacrataegus marshalliicrataegus molliscrataegus monogyna
crataegus oxyacanthacrataegus oxycanthacrataegus pedicella…crataegus tomentosa
cratchcratecratedcrateful
crateloadcratercrater facecrater lake
crater lake nationa…crater moundcrateredcrateriform
cratering chargecraterlesscraterletcraterlike
craterostigmacraterouscraters of the mooncrates
cratevacratingcratinuscratippus
cratippus of athenscratolagniacratoncratonic
craturcraturelesscratyluscraugastor augusti
craunchcraunchedcraunchingcravat
cravattedcravecravedcraven
cravenedcravenettecraveningcravenly
cravennesscravercravingcravingness
crawcrawdadcrawdaddycrawdaddy!
crawfishcrawfish outcrawfordcrawford and balcar…
crawford, marioncrawford, thomascrawforditecrawk
crawlcrawl incrawl spacecrawl with
crawlablecrawledcrawlercrawley
crawlingcrawling back to youcrawling horrorcrawlspace
crawlycraxcraycraye
crayercrayer, caspar decrayettecrayfish
crayfishercrayfishermancrayfisherycrayola
crayoncrayonedcrayoningcrayonlike
craythurcrayturcrazecraze-mill
crazedcrazedlycrazednesscrazily
crazinesscrazingcrazing-millcrazy
crazy bitchcrazy bonecrazy eightscrazy eyes
crazy gluecrazy golfcrazy horsecrazy house
crazy like a foxcrazy pavingcrazy quiltcrazy weed
crazy-asscrazyweedcrccrc handbook
crécreablecreacionismocreaght
creakcreakedcreakilycreakiness
creakingcreakinglycreakle, mr.creaky
creamcream cakecream cheesecream corn
cream crackercream crackeredcream in ones jeanscream laid
cream of tartarcream of the cropcream of wheatcream off
cream piecream pitchercream puffcream sauce
cream sodacream teacream upcream violet
cream-coloredcream-colored cours…cream-facedcream-fruit
cream-of-tartar treecream-slicecream-whitecreamcake
creamcupscreamedcreamed corncreamer
creameriescreamerycreamilycreaminess
creamingcreamlesscreamlikecreampie
creamsiclecreamwarecreamycreance
creantcreasecrease-resistantcreased
creaselesscreaseproofcreasercreaseyite
creashakcreasingcreasotecreasy
creasy, sir edwardcreatcreatablecreate
create (dc)create by mental actcreate from raw mat…create from raw stu…
create mentallycreate verballycreate, read, updat…created
created bycreatescreaticcreatin
creatinecreatine kinasecreatine kinase, bb…creatine kinase, mb…
creatine kinase, mi…creatine kinase, mm…creatine phosphatecreatine phosphoric…
creatingcreating by mental …creating by removalcreating from raw m…
creating one fleshcreatinincreatininasecreatinine
creationcreation sciencecreationalcreationarily
creationarycreationismcreationistcreationistic
creativasc medicalcreativecreative accountingcreative activity
creative alliescreative artists ag…creative brain stud…creative circle adv…
creative citizencreative commonscreative commons li…creative destruction
creative differencescreative energycreative personcreative skillset
creative thinkercreative thinkingcreative workcreative writing
creativelivecreativelycreativenesscreativity
creatorcreatorlesscreatorlikecreators
creatorshipcreatresscreatrixcreatural
creaturecreature comfortcreature comfortscreature feature
creaturedomcreaturelesscreaturelikecreatureliness
creaturelycreaturescreatures of habitcreatureship
creaturizecreazecrebcreb-binding protein
crébilloncrebricostatecrebrisulcatecrebritude
crebrouscrechecrécycred
credalcredant technologiescredencecredence table
credendacredendumcredentcredential
credentialedcredentialingcredentialismcredentialization
credentialscredenzacrederitycredibility
credibility gapcrediblecrediblenesscredibly
creditcredit accountcrédit agricole co…credit analyst
credit applicationcredit bureaucredit cardcredit card fraud
credit card tartcredit crunchcredit default opti…credit default swap
credit entrycredit eventcrédit fonciercredit hour
credit limitcredit linecredit mobiliercredit note
credit ordercredit ratingcredit referencecredit report
credit riskcredit scorecredit score in the…credit sesame
credit sidecredit systemcredit transfercredit union
credit-deposit ratiocreditabilitycreditablecreditableness
creditablycreditedcreditingcreditless
créditocreditorcreditor's rightscreditors rights
creditresscreditrixcreditscreditworthiness
creditworthycredneritecredocredobaptist
credophilecredoraxcredulitivenesscredulity
credulouscredulouslycredulousnesscree
creech, williamcreedcreedalcreedite
creedlesscreedmorecreekcreek bed
creek confederacycreekfishcreekfrontcreekology
creekscreeksidecreekwatercreeky
creelcreelercreemcreep
creep feedcreep increep intocreep joint
creep someone outcreep upcreep up oncreepage
creepercreepethcreepholecreepie
creepifycreepilycreepinesscreeping
creeping barragecreeping bellflowercreeping bentcreeping bentgrass
creeping buglecreeping buttercupcreeping charliecreeping crowfoot
creeping elegancecreeping featurismcreeping featuritiscreeping fern
creeping jennycreeping junipercreeping lilycreeping mine
creeping oxaliscreeping snowberrycreeping soft grasscreeping spike rush
creeping st john's …creeping thistlecreeping thymecreeping willow
creeping windmill g…creeping wintergreencreeping wood sorrelcreeping zinnia
creepinglycreeplecreepmetercreeps
creepycreepy-crawliescreepy-crawlycreepy-peepy
creescreesecreftingcreighton, mandell
cremacremaillerecremainscremaster
cremastericcrematecremationcremation chamber
cremationistcrematorcrematorialcrematories
crematoriumcrematoriumscrematorycreme
creme anglaiscreme bruleecreme caramelcreme de cacao
creme de fraisecreme de menthecrème fraîchecrémieux
cremo, west virginiacremocarpcremonacremor
cremornecremosincremscremulator
crenarchaealcrenarchaeoncrenarchaeotacrenarchaeotal
crenarchaeotecrenatecrenate leafcrenated
crenationcrenaturecrenelcrenelate
crenelatedcrenelated moldingcrenelatingcrenelation
crenellatecrenellatedcrenellated mouldingcrenellation
crenellecrenelledcrenglecrenic acid
crenklecrenotherapycrenshawcrenulate
crenulatedcrenulationcreocreodont
creolecreole statecreole-fishcreolean
creoliancreolincreolizationcreolize
creoncreopointcreosolcreosote
creosote bushcreosotedcreosotelikecreosoting
crepcrepancecrepanecrepe
crepe de chinecrepe ferncrepe flowercrepe gardenia
crepe jasminecrepe marocaincrepe myrtlecrepe paper
crepe rubbercrepe suzettecrepelikecreperie
crepeycrepidomacrepiscrepitant
crepitatecrepitatedcrepitatingcrepitation
crepitation ralecrepitouscrepituscrepon
creptcrepusclecrepuscularcrepuscular ray
crepuscularitycrepuscularlycrepusculecrepusculine
crepusculouscrepusculumcreraritecres
crescencecrescendocrescendo biosciencecrescent
crescent citycrescent mooncrescent rollcrescent unmanned s…
crescent-cell anaem…crescent-cell anemiacrescent-shapedcrescentia
crescentia cujetecrescenticcrescentinicrescentius
crescentwisecrescivecrescocrescograph
cresolcresolatecresorcincrespelle
crespi, giuseppecrespinecrespocress
cress greencress plantcressellecresses
cressetcressidacresslikecresson
cressycrestcrest cloudcrest syndrome
crestatechcrestedcrested cariamacrested coral root
crested larkcrested mynacrested penguincrested screamer
crested swiftcrested titcrested wheat grasscrested wheatgrass
crestfallencrestiecrestingcrestless
crestless wavecrestmontcrestone telecomcreswell, sir cresw…
creswick, thomascresylcresyliccreta, oklahoma
cretaceancretaceouscretaceous periodcretaceously
cretaciouscretancretan dittanycrete
crete dittanycretiancreticcreticism
cretincretinisecretinismcretinize
cretinoidcretinouscretismcretonne
cretorcretosecreusacreuse
creusot, lecreutzercreutzfeldt-jakob d…creutzfeldt-jakob s…
creutzfeldt–jakob…creuxcreuzercrevalle
crevalle jackcrevantcrevassecrèvecœur
crevetcrevicecrevice corrosioncreviced
creviscrewcrew chiefcrew cut
crew membercrew neckcrew necklinecrew sock
crew-served weaponcrewcutcrewecrewed
crewelcrewelworkcrewercrewet
crewlesscrewmancrewmatecrewmember
crewneckcrewneckedcrexcrex crex
crfscrgcri de coeurcri de coeur*
cri du chat syndromecri technologiescri-du-chat syndromecria
cribcrib boardcrib deathcrib mattress
crib notecrib sheetcrib-bitercrib-biting
cribbagecribbage boardcribbedcribber
cribbingcribblecribbledcribbling
cribellumcribercriblikecribrate
cribrationcribriformcribriform platecribrose
cribrouscriccricetidcricetidae
cricetinaecricetuluscricetuscricetus cricetus
crichtoncrichton, jamescrichtonitecricify
crickcricketcricket ballcricket bat
cricket equipmentcricket fieldcricket frogcricket ground
cricket matchcricket pitchcricket whitescricket-bat willow
cricketercricketingcricketlesscrickets
cricketycricoidcricoid cartilagecricondentherm
cricothyroidcricothyroidotomycriddleitecried
crieffcriercriescriest
crigancrigler-najjar synd…crigler–najjar sy…crikey
crilecrilloncrimcrimble
crimbocrimecrime against human…crime against nature
crime analysiscrime and punishmentcrime fictioncrime lord
crime of passioncrime preventioncrime ratecrime scene
crime statisticscrime syndicatecrime victimscrime wave
crime-riddencrimeacrimea-congo hemorr…crimean
crimean peninsulacrimean tatarcrimean warcrimebuster
crimebustingcrimefightercrimefightingcrimefree
crimefulcrimelesscrimelikecrimereports
crimeriddencrimescrimes against huma…crimethinc.
crimethinkcrimewarecrimewatch uscrimewave
crimidinecriminalcriminal activitycriminal congress
criminal contemptcriminal conversati…criminal courtcriminal intelligen…
criminal intentcriminal investigat…criminal lawcriminal negligence
criminal offencecriminal possessioncriminal procedurecriminal prosecution
criminal psychologi…criminal psychologycriminal recordcriminal suit
criminalisationcriminalisecriminalismcriminalist
criminalisticscriminalitycriminalizationcriminalize
criminallycriminalnesscriminaloidcriminals
criminatecriminatedcriminatingcrimination
criminativecriminatorycriminicriminogenically
criminol.criminologicalcriminologistcriminology
criminouscriminousnesscriminycrimosin
crimpcrimpagecrimpedcrimper
crimpingcrimplecrimpledcrimpling
crimpnesscrimpycrimsoncrimson clover
crimson glorycrimson hexagoncrimson informaticscrimsoned
crimsoningcrimsonlycrimsonnesscrinal
crinan canalcrinatedcrinatorycrincum
crincum-crancumcrinedcrinelcrinet
cringecringelingcringemakingcringer
cringeworthycringingcringinglycringingness
cringlecringycriniculturalcriniere
crinigerouscrinioncrinitalcrinite
crinitorycriniviruscrinklecrinkle root
crinkle-rootcrinkledcrinklerootcrinkliness
crinklingcrinklycrinkycrinoid
crinoidalcrinoideacrinoideancrinoline
crinolinedcrinosecrinositycrinum
crioboliumcriollocriollo peoplecriosphinx
crioulocripcripescripple
cripple creekcrippledcrippled insidecrippleness
cripplercripplewarecripplingcripplingly
cripplycripscriptcrisco
crisescrisiscrisis action plann…crisis center
crisis interventioncrisis managementcrisis negotiationcrisis-ridden
crispcrisp breadcrispatecrispated
crispationcrispaturecrispbreadcrisped
crispencrispercrisphead lettucecrispi, francesco
crispilycrispincrispin and crispin…crispiness
crispingcrisplycrispnesscrisps
crispuscrispus attucks: a …crispycrispy gamer
crispy!criss crosscriss-crosscriss-cross applesa…
crissacrissalcrisscrosscrisscross heart
crisscross-rowcrisscrossedcrissumcrist
cristacristalcristalinacristallo
cristallologycristatecristinacristo redentor
cristobalcristobal balenciagacristóbal carbinecristobal colon
cristobalitecristoforo colombocritcrit.
critchfieldcriteriacriterialcriterion
criterionalcriterionlesscriterionscriterior
criteriumcrithcrithidiacrithidia fascicula…
crithomancucrithomancycritiascritic
criticalcritical acclaimcritical analysiscritical angle
critical appraisalcritical assetcritical asset listcritical capability
critical carecritical conditioncritical control po…critical diagnostics
critical discourse …critical functioncritical illnesscritical information
critical infrastruc…critical inquirycritical intelligen…critical item
critical item listcritical joint duty…critical literacycritical mass
critical mediacritical micelle co…critical occupation…critical opalescence
critical pathcritical path methodcritical pathwayscritical period
critical period (ps…critical pointcritical practicecritical rationalism
critical requirementcritical reviewcritical reynolds n…critical section
critical speedcritical supplies a…critical sustainabi…critical technologi…
critical theorycritical thinkingcritical tide levelcritical update
critical valuecritical vulnerabil…criticalitycriticality assessm…
criticallycritically acclaimedcriticalmetricscriticalness
criticastercriticisablecriticisecriticised
criticisercriticisingcriticismcriticisms of globa…
criticizablecriticizationcriticizecriticizer
criticizinglycriticocriticproofcritics
critiquecritique^itcrititechcriton
crittercritter sittercrittercismcritters
criuscrix labscrixivancrizzel
crizzlecrizzledcrk-associated subs…crlf
crm softwarecrna goracrngedcro
croûtecro-magnoncro-quettecroagh
croakcroakedcroakercroaking
croakycroatcroatiacroatian
croatian peasant pa…croatian sheepdogcroato-serbiancroats
croa`tia and slavon…croccrocacincrocanthemum canade…
crocecroceincroceouscrocethia
crocethia albacrocetincrochecrochet
crochet hookcrochet needlecrochet stitchcrocheted
crochetercrochetingcrochetworkcrochu
crociarycrocidolitecrocincrock
crock of goldcrock of shitcrock potcrock up
crockedcrockercrockerscrockery
crocketcrocketedcrocketingcrockett
crockett, samuel ru…crockingcrockpotcrocky
crocodilecrocodile birdcrocodile clipcrocodile river
crocodile tearcrocodile tearscrocodilelikecrocodilia
crocodiliancrocodilian reptilecrocodilitycrocodilus
crocodoccrocodyliacrocodylidaecrocodyliform
crocodylomorphcrocodyluscrocodylus niloticuscrocodylus porosus
crocoisitecrocoitecrocolitecroconate
croconazolecroconiccroconic acidcrocose
crocosmiacrocottacrocscrocus
crocus sativuscrocus technologycrocuslikecrocuta
crocuta crocutacroesuscroftcrofter
croftingcroftlandcrohncrohn disease
crohn's diseasecrohns diseasecroirecrois
croisadecroisadocroisecroissant
croissantecroissantlikecrois\u00e9croix de guerre
crokercroker, john wilsoncroker, t. croftoncroll, james
croly, georgecromacromagnoncromakalim
cromarcromartycromecrome, john
cromlechcromniomancycromoglicatecromoglicic acid
cromoglycatecromolyncromolyn sodiumcromorna
cromornecromptoncrompton urban dist…crompton, samuel
cromulentcromwellcromwell (oliver)cromwell, oliver
cromwell, richardcromwell, thomascromwelliancronartium
cronartium ribicolacronecronelcronelike
cronenbergiancronetcroniancronies
cronkcronocronotecronstadt
cronstedtitecrontabcronuscronusite
cronycronyismcronyisticcroo monkey
croodlecrookcrook and nannycrookack
crookbackcrookbackedcrookbillcrooked
crooked-stemmed ast…crookedlycrookednesscrooken
crookerycrookescrookes radiometercrookes tube
crookes, williamcrookesitecrookingcrookneck
crookneck squashcrookscrooncrooned
croonercrooningcroonycrop
crop circlecrop failurecrop outcrop residue
crop rotationcrop topcrop upcrop ventures
crop-dustingcrop-earcrop-earedcrop-tailed
cropboundcropdustercropecropful
croplandcroplandscroplikecroppable
croppedcroppercroppingcrops, agricultural
cropsickcropupcroque-madamecroque-monsieur
croquembouchecroquetcroquet ballcroquet equipment
croquet malletcroquetacroquetedcroqueting
croquetlikecroquettecroquiscrore
crorepaticrosbycroscarmellosecrosier
crosieredcrosletcrosnecrospovidone
crosscross a bridge befo…cross batcross bit
cross buncross channelcross checkcross circulation
cross compilercross connectioncross countrycross cover version
cross crossletcross dressingcross examinationcross examine
cross fellcross firecross florycross hair
cross hairscross infectioncross junctioncross matching
cross merchandisingcross multiplycross of calvarycross of gold
cross of gold speechcross of lorrainecross offcross one's eyes
cross one's fingerscross ones armscross ones fingerscross ones heart
cross oneselfcross outcross overcross paths
cross patt\u00e9ecross peen hammercross pixel mediacross post
cross productcross protectioncross purposecross purposes
cross questioncross reactionscross referencecross roads
cross seacross sectioncross someones palmcross someones path
cross streetcross swordscross tabcross tabulation
cross talkcross tellcross that bridge w…cross the aisle
cross the floorcross the linecross the rubiconcross thwart
cross vinecross windcross wirecross, mrs.
cross, southerncross, victoriacross-cross-action
cross-armedcross-bandedcross-bearercross-bedding
cross-benchcross-benchercross-birthcross-border
cross-bredcross-breedcross-breedingcross-browser
cross-buncross-capcross-channelcross-check
cross-classificationcross-compatiblecross-connecting bo…cross-console emula…
cross-contaminatecross-contaminationcross-correlationcross-country
cross-country jumpi…cross-country ridingcross-country skiingcross-cousin
cross-crossletcross-culturalcross-cultural comp…cross-cutting
cross-dayscross-divisioncross-dockingcross-dress
cross-dressercross-dressingcross-examinationcross-examine
cross-examinedcross-examinercross-examiningcross-eye
cross-eyedcross-fertilecross-fertilisationcross-fertilise
cross-fertilizationcross-fertilizecross-filecross-fire
cross-fostercross-fosteringcross-garnetcross-grained
cross-indexcross-infectioncross-jack yardcross-lag
cross-leaved heathcross-leggedcross-levelingcross-light
cross-linguisticcross-linguisticallycross-linkcross-linkage
cross-linkedcross-linking reage…cross-loading (pers…cross-magnetizing e…
cross-modalcross-multiplicationcross-multiplycross-over block
cross-over studiescross-partycross-patchcross-pawl
cross-phrasingcross-platformcross-plycross-pollinate
cross-pollinatingcross-pollinationcross-primingcross-purpose
cross-questioncross-questionedcross-questionercross-questioning
cross-ratiocross-reactcross-reactioncross-reactivity
cross-readingcross-refercross-referencecross-resistance
cross-sectioncross-sectionalcross-sectional stu…cross-sell
cross-sellingcross-sententialcross-servicingcross-shaped
cross-spalecross-spallcross-springercross-staff
cross-stitchcross-stitchercross-stonecross-tab
cross-tailcross-targeting (nu…cross-tiecross-tining
cross-tolerancecross-towncross-traincross-training
cross-treescross-validationcross-vaultingcross-week
crossbandcrossbandingcrossbarcrossbarred
crossbeakcrossbeamcrossbeam systemscrossbench
crossbenchercrossbenchescrossbillcrossbite
crossbodycrossbonescrossborderscrossbow
crossbow technologi…crossbowercrossbowmancrossbracing
crossbredcrossbreedcrossbreedercrossbreeding
crossbuckcrosscheckcrosschxcrossclaim
crossclasscrosscorrelationcrosscoupledcrosscoupling
crosscourtcrosscurrentcrosscutcrosscut saw
crosscuttingcrossecrosse, andrewcrossectional
crossedcrossed eyecrossed fingerscrossed loop sensor
crossed outcrossercrossettecrosseyed
crossfadecrossfadercrossfeedcrossfiber
crossfieldcrossfirecrossfirst bankcrossfish
crossflowcrossgendercrossgradecrossgrained
crossguardcrosshaircrosshairscrosshatch
crosshatchedcrosshatchingcrossheadcrossheading
crossingcrossing areacrossing automationcrossing guard
crossing numbercrossing overcrossing over, gene…crossing the line
crossing wirescrossingscrossjackcrosslegged
crossletcrosslicensecrosslightcrosslike
crosslinearcrosslinearlycrosslinguisticcrosslink
crosslinkercrossloadcrossloopcrosslots
crosslycrossmatchcrossmatchedcrossmember
crossmetathesiscrossnathcrossnationalcrossness
crossopterygiancrossopterygiicrossovercrossover dribble
crossover health ma…crossover votecrossover votercrosspatch
crosspiececrosspipecrossplaycrossplayer
crosspointcrosspostcrosspostercrossraguel
crossrangecrossreactcrossreactioncrossreactive
crossrefcrossroadcrossroadscrossroads systems
crossrowcrossruffcrosstabcrosstalk
crosstiecrosstowncrosstreecrosstrees
crosstxcrosswalkcrosswaycrossways
crossways, dorsetcrosswindcrosswisecrossword
crossword (puzzle)crossword puzzlecrosswordlikecrossworld warranty
crosswortcrostatacrostinicrotal
crotalariacrotalaria sagitall…crotalaria spectabi…crotalid venoms
crotalidaecrotalinecrotalocrotalum
crotaluscrotalus adamanteuscrotalus atroxcrotalus cerastes
crotalus horridus a…crotalus horridus h…crotalus lepiduscrotalus mitchellii
crotalus scutulatuscrotalus tigriscrotalus viridiscrotamiton
crotanaldehydecrotaphioncrotaphitecrotaphitic
crotaphytuscrotchcrotch fruitcrotch hair
crotch rocketcrotch, williamcrotchedcrotches
crotchetcrotchet restcrotchetedcrotchetiness
crotchetycrotchlesscrotoncroton bug
croton eluteriacroton oilcroton tigliumcrotona
crotonaldehydecrotonamidecrotonatecrotonates
crotonbugcrotonecrotoniccrotonic acid
crotonic acidscrotoninecrotonylenecrotophaga
crotoxincrottalcrottlecrottles
crotylcrotylationcrotylborationcrouch
crouch downcrouchedcrouchercrouching
croudcroukecroupcroupade
croupalcroupecroupercroupier
croupier's rakecroupierecroupinesscroupous
croupycrousecroustadecrout
croutoncrouzon syndromecrowcrow blackbird
crow corncrow garliccrow pheasantcrow point
crow scarercrow stepcrow's feetcrow's foot
crow's nestcrow's-feetcrow's-footcrow's-nest
crow-baitcrow-quillcrow-silkcrow-trodden
crowbaitcrowbarcrowbar hotelcrowberry
crowberry familycrowdcrowd artcrowd catch
crowd controlcrowd intocrowd outcrowd play
crowd sciencecrowd supplycrowd surfercrowd surfing
crowd technologiescrowd togethercrowd upcrowd-poisoning
crowdboostercrowdcastcrowdcompasscrowdcomputing syst…
crowdedcrowdengineeringcrowdercrowders
crowdfeedcrowdflikcrowdflowercrowdfunder
crowdfundingcrowdgathercrowdhallcrowdie
crowdingcrowdlikecrowdlycrowdmed
crowdmobcrowdopticcrowdpleasercrowdrise
crowdscrowdslingcrowdsourcecrowdsourced
crowdsourcingcrowdspringcrowdstarcrowdstrike
crowdtapcrowdtiltcrowdtwistcrowdvance
crowdycrowdzonecrowdzucrowe, eyre evans
crowe, sir james ar…croweatercrowedcrowflower
crowfootcrowfoot familycrowfoot grasscrowing
crowkeepercrowleyancrowlikecrown
crown beardcrown biosciencecrown cactuscrown colony
crown compoundscrown courtcrown daisycrown estate
crown ethercrown etherscrown firecrown flower
crown gallcrown glasscrown graftingcrown green
crown green bowlscrown imperialcrown in towncrown jewel
crown jewelscrown landcrown lengtheningcrown lens
crown mammalcrown moldingcrown monkeycrown of thorns
crown officecrown pointcrown princecrown princess
crown roastcrown sawcrown sidecrown vetch
crown viccrown wardcrown wartcrown wheel
crown-beardcrown-imperialcrown-of-the-fieldcrown-post
crown-rump lengthcrown-sawcrownbeardcrowne, john
crownedcrowned cranecrowned headcrowned pigeon
crownedstcrownercrownetcrowning
crownlesscrownletcrownlikecrownpeak
crownpiececrownscrownworkcrows
crows feetcrows footcrows nestcrowstep
crowstonecrowthcrowther, samuel ad…crowtoe
croycroydoncroydon faceliftcroylstone
croyncroyscrozecroze iron
croziercrozieredcrpcrs reprocessing se…
crtcrt screencrtscru
crubeenscrucescruces, cubacrucial
crucialitycruciallycruciancrucian carp
cruciatecruciate sulcuscruciationcrucible
crucible steelcrucible, electriccrucifercruciferae
cruciferouscruciferous plantcruciferous vegetab…crucified
crucifiercrucifixcrucifix fishcrucifixes
crucifixioncrucifixionlikecrucifixlikecruciform
crucifycrucifyingcrucigerouscruciverbalism
cruciverbalistcruckcrudcruddiness
cruddlecruddycrudecrude oil
crude sapcrude-oilcrudelycruden, alexander
crudenesscruditéscruditiescrudity
crudlecrudoscrudwarecrudy
cruelcruel and unusual p…cruel plantcruella de vil
cruellycruelnesscruelscruelties
crueltycruentarencruentatecruentous
cruetcruet-standcruftcruft together
cruftscruftsmanshipcruftycruikshank
cruikshank, georgecruiscruisecruise control
cruise linecruise linercruise missilecruise ship
cruisedcruiselikecruisercruiserweight
cruisewearcruisewisecruisingcruising altitude
cruising levelcruisycruivecrull
crullercrumcrumbcrumb cake
crumb downcrumbclothcrumbedcrumber
crumbilycrumbinesscrumbingcrumblable
crumblecrumbledcrumblercrumbless
crumbletcrumblikecrumblinesscrumbling
crumblinglycrumblingscrumblycrumbs
crumbumcrumbycrumcakecrumenal
crumhorncrummablecrummilycrumminess
crummockcrummycrumpcrumpet
crumpinesscrumplecrumple zonecrumpled
crumplednesscrumplercrumplingcrumply
crumpycrunchcrunch numberscrunch time
crunchablecrunchedcrunchercrunchiness
crunchingcrunchinglycrunchycrunchyroll
crunkcrunklecrunodalcrunode
cruorcruorincrupcrupper
cruracruralcrurophiliacrurotarsal
cruscrusadecrusadedcrusader
crusaderlikecrusaderscrusadescrusades, the
crusadingcrusadocrusecruse, illinois
crusetcrushcrush hatcrush on
crush on youcrush outcrush partycrush room
crush syndromecrushablecrushblvdcrushed
crushed leathercrushed rockcrushed sugarcrushee
crushercrusher gaugecrushingcrushingly
crushpathcrushproofcrusoe, robinsoncrust
crustacrustaceacrustaceancrustacean larvae
crustaceologicalcrustaceologistcrustaceologycrustaceous
crustaceousnesscrustalcrustal movementcrustal plate
crustalogicalcrustalogistcrustalogycrustated
crustationcrustedcrustiecrusties
crustificcrustilycrustinesscrusting
crustlesscrustlikecrustosecrustose thallus
crustquakecrustycrutcrutch
crutchedcrutchescrutchlikecruth
cruttercruxcrux australiscrux biomedical
crux gammatacrux of the mattercrux simplexcruxes
cruyff turncruz recordscruzacruzado
cruzadoscruzancruzeirocrwth
crycry all the way to …cry blue murdercry down
cry forcry for helpcry havoccry in ones beer
cry like a babycry like a little g…cry me a rivercry off
cry ones eyes outcry outcry out againstcry out for
cry someone a rivercry the bluescry unclecry uncle!
cry wolfcry-babycry-baby treecryaesthesia
cryalcrybabycrybaby treecryer
cryesthesiacryin'cryingcrying bird
crying callcrying shamecryo-cryo-electron micro…
cryo-transmissioncryo-transmission e…cryoablationcryoactivation
cryoanaesthesiacryoanesthesiacryobenchcryobiological
cryobiologistcryobiologycryobiosiscryobiotic
cryobuffercryocardioplegiacryocauterycryochrept
cryocondensationcryoconitecryocooledcryocooler
cryocoolingcryocrystallographycryodetectorcryoelectron
cryoelectron micros…cryoelectroncscryoelectroniccryoelectronics
cryofixationcryofixedcryofocuscryofocusing
cryogencryogenesiscryogeniancryogenic
cryogenic liquidcryogenicallycryogenicscryogenine
cryogenycryoglobulincryoglobulinemiacryoglobulins
cryohydratecryohydriccryokinesiscryolathe
cryolitecryolithionitecryoliticcryomagnetic
cryometercryometriccryometrycryomicrograph
cryomicroscopiccryomicroscopycryomodulecryonic
cryonicscryopathycryopelagiccryophilic
cryophobiacryophoruscryophysicscryophyte
cryoplanktoncryoportcryoprecipitatecryopreservation
cryopreservecryopreservedcryopreservingcryoprobe
cryoprotectcryoprotectedcryoprotectioncryoprotective agen…
cryopumpcryopyrincryopyrin-associate…cryoregime
cryosamplingcryoscopecryoscopiccryoscopy
cryosectioncryosectionedcryosectioningcryosleep
cryosolventcryospherecryosphericcryostasis
cryostatcryostaticcryosurgeoncryosurgery
cryosurgicalcryosurgicallycryotechnologycryotemperature
cryotherapistcryotherapycryotomographiccryotomography
cryotrapcryotrappingcryotroncryoturbation
cryoultramicrotomycryovialcryovolcaniccryovolcanism
cryovolcanocryoxtract instrume…cryppiecrypsis
cryptcryptacanthodescryptacanthodes mac…cryptal
cryptanalysiscryptanalystcryptanalyticcryptanalytics
cryptandcryptarithmcryptatecryptic
cryptic colorationcryptic crosswordcrypticalcryptically
crypticitycryptidcryptidinecryptlike
cryptocrypto-crypto-fascismcrypto-fascist
crypto-fascisticcrypto-revisionismcryptobiontcryptobiosis
cryptobioticcryptobranchiatacryptobranchiatecryptobranchidae
cryptobranchuscryptobranchus alle…cryptocaryacryptocercidae
cryptocercuscryptochannelcryptochiralcryptochirality
cryptochromecryptochromescryptococcalcryptococcosis
cryptococcuscryptococcus gattiicryptococcus neofor…cryptocoryne
cryptocracycryptocrystallinecryptodepressioncryptoexotic
cryptogamcryptogamecryptogamiacryptogamiae
cryptogamiancryptogamiccryptogamistcryptogamous
cryptogeniccryptogenic organiz…cryptogenic speciescryptogram
cryptogrammacryptogramma acrost…cryptogramma crispacryptogrammataceae
cryptogrammaticcryptogrammaticallycryptogramscryptograph
cryptographalcryptographercryptographiccryptographic infor…
cryptographicalcryptographicallycryptographistcryptography
cryptohalitecryptolaliacryptolectcryptolepis
cryptologiccryptologicalcryptologistcryptology
cryptomariacryptomaterialcryptomelanecryptomeria
cryptomeria japonicacryptomnesiacryptomodulecryptomonad
cryptomorphiccryptomorphismcryptoncryptonephridial
cryptonymcryptonymiccryptopartcryptophane
cryptophonecryptophthalmoscryptophyceaecryptophyta
cryptophytecryptopinecryptoporticuscryptoprocessing
cryptoprocessorcryptoproctacryptoprocta feroxcryptorchid
cryptorchidismcryptorchidycryptorchismcryptospora
cryptosporidiidaecryptosporidiosiscryptosporidiumcryptosporidium par…
cryptosystemcryptotermescryptotermes breviscryptotis
cryptotis parvacryptotomographycryptoxanthincryptozoological
cryptozoologistcryptozoologycrypturicrystal
crystal ballcrystal clearcrystal countercrystal detector
crystal gazingcrystal healingcrystal iscrystal lattice
crystal methcrystal microphonecrystal momentumcrystal oscillator
crystal pickupcrystal pleatcrystal radiocrystal rectifier
crystal setcrystal structurecrystal teacrystal twinning
crystal violetcrystal-clearcrystalgenomicscrystalisation
crystalisecrystalisedcrystalizecrystalized
crystalliferouscrystallincrystallinecrystalline fructose
crystalline humourcrystalline lenscrystallinitycrystallins
crystallisationcrystallisecrystallisedcrystallite
crystallizabilitycrystallizablecrystallizationcrystallization, el…
crystallizecrystallizedcrystallized fruitcrystallized ginger
crystallizercrystallizingcrystallo-crystalloclast
crystallogenesiscrystallogeniccrystallogenicalcrystallogeny
crystallogeometricalcrystallographercrystallographiccrystallographical
crystallographicallycrystallographycrystallography, x-…crystalloid
crystallomancycrystallometrycrystallophonecrystallurgy
crystalluriacrystalplexcry_wolfcr\u00e8che
cr\u00e8me anglaisecr\u00e8me br\u00fb…cr\u00e8me caramelcr\u00e8me de cacao
cr\u00e8me de cassiscr\u00e8me de la cr…cr\u00e8me de menthecr\u00e8me fra\u00e…
cr\u00e9maill\u00e8…cr\u00eape de chinecr\u00eape papercr\u00eape suzette
cr\u00eapy   

The Web's Largest Resource for

Definitions & Translations


A Member Of The STANDS4 Network