Found 3,173 definitions starting with CR:

crcrêpesuzettecrèchecrème
crèmedecacaocrèmedecassiscrèmedelacr&…crèmedementhe
crèmefra&ici…crèvecoeurcr.cr/che
crabcrab applecrab boilcrab burger
crab cactuscrab canoncrab cocktailcrab grass
crab legscrab louiscrab lousecrab mentality
crab nebulacrab rangooncrab spidercrab tree
crab-eatercrab-eating dogcrab-eating foxcrab-eating macaque
crab-eating opossumcrab-eating raccooncrab-eating sealcrab-plover
crab-yawscrabapplecrabapple jellycrabbe, george
crabbedcrabbedlycrabbednesscrabber
crabbilycrabbinesscrabbingcrabbish
crabbitcrabburgercrabbycrabby person
crabeatercrabeater sealcrabercrabfaced
crabgrasscrabletcrablikecrabmeat
crabronidcrabscrabsidlecrabstick
crabwisecrac!crachecracid
cracidaecrackcrack a bookcrack a crib
crack a fatcrack a smilecrack a smile... an…crack addict
crack babycrack cocainecrack downcrack down (on)
crack down oncrack ficcrack housecrack of dawn
crack of doomcrack oncrack ones fingerscrack onto
crack pipecrack rockcrack rootcrack seed
crack shotcrack throughcrack traincrack up
crack whorecrack willowcrack wisecrack-brained
crack-pipecrack-upcrackacrackable
crackbackcrackberrycrackbraincrackbrained
crackdowncrackedcracked tooth syndr…cracked wheat
cracked-wheat breadcrackednesscrackercracker bonbon
cracker boxcracker crumbscracker jackcracker jacks
cracker-barrelcrackerberrycrackerboxcrackerjack
crackerlesscrackerlikecrackerscrackhead
crackhousecrackingcracking upcrackle
crackle chinacrackle – the bes…crackleberrycrackled
cracklescracklewarecracklikecrackling
cracklinglycracklingscracklinscrackly
cracknelcrackowcrackpipecrackpot
crackpotterycrackproofcrackscracksman
cracksmencracktivismcracktrocrackup
crackwhorecrackycracky wagoncracovian
cracoviennecracowcracowescracticidae
cracticinaecracticuscradd signaling ada…cradgedness
cradlecradle capcradle catholiccradle mountain
cradle of civilizat…cradle robbercradle snatchercradle technologies
cradle-to-cradle de…cradle-to-gravecradleboardcradled
cradlelikecradlesongcradlingcraft
craft centrecraft faircraft unioncrafted
craftednesscraftercraftilycraftiness
craftlesscraftlikecrafts centrecraftsman
craftsmanlikecraftsmanlycraftsmanshipcraftsmaster
craftsmencraftspersoncraftspersonshipcraftswoman
craftswomanshipcraftsycraftworkcraftworker
craftycragcragfastcragged
craggednesscraggercraggilycragginess
craggycragscragsmancragsmen
craiccraiecraigcraig flounder
craig serani marshcraig ventnercraig, johncraig, sir thomas
craigenputtockcraigiecraigslistcraigslist inc.
craigslistercraigslistingcraikcraik, george little
craik, mrs.crailcraincraiova
craisincrakecrakeberrycraker
crakowcramcram downcram full
cram schoolcram sessioncram worldwidecram-full
crambecrambe maritimacrambe plantcrambe sponge
crambocrambucramdowncramer
cramer, johann bapt…cramlingtoncrammedcrammer
crammingcramoisiecramoisycramp
cramp ironcramp someones stylecrampbarkcramped
crampednesscrampetcrampfishcrampiness
crampingcrampitcramponcramponee
cramponscrampooncrampoonscramps
crampycramstercrancranach
cranach, lucascranachancranagecranapple
cranberriescranberrycranberry bushcranberry culture
cranberry heathcranberry juicecranberry morphemecranberry sauce
cranberry treecranberryingcranberrylikecrance
cranchcrandallitecranecrane fly
crane shotcrane's billcrane's-billcrane, ichabod
crane, waltercrane-drivercranedcranefly
cranelikecranescranesbillcrang
crangoncrangonidaecranhamcrania
cranialcranial cavitycranial fontanellescranial fossa, ante…
cranial fossa, midd…cranial fossa, post…cranial indexcranial irradiation
cranial nervecranial nerve disea…cranial nerve injur…cranial nerve neopl…
cranial nervescranial orbitcranial sinusescranial sutures
craniallycraniatacraniatecranidium
craniectomycraningcraniocaudalcraniocerebral trau…
cranioclasmcranioclastcraniodentalcraniofacial
craniofacial abnorm…craniofacial abnorm…craniofacial dysost…craniofacially
craniognomycraniologicalcraniologicallycraniologist
craniologycraniomandibularcraniomandibular di…craniometer
craniometriccraniometric pointcraniometricalcraniometry
craniopaguscraniopharyngiomacraniosacralcranioscopist
cranioscopycraniosophiccraniosynostosescraniosynostosis
craniotacraniotomycranite systemscranium
craniumscrankcrank anglecrank angle degree
crank callcrank handlecrank lettercrank out
crank sciencecrank upcrankbirdcrankcase
crankedcrankilycrankinesscrankle
cranknesscrankpincrankscrankset
crankshaftcrankycranmercranmer, thomas
cranniedcranniescrannockcrannog
crannogecrannycrannyingcranston
crantcrantaracrantscrap
crap artistcrap gamecrap on a stickcrap ones pants
crap outcrap shootingcrap upcrap-shooter
crapaudcrapaud, jeancrapaudinecrape
crape ferncrape jasminecrape myrtlecraped
crapefishcrapehangercrapelikecrapette
crapfacecrapfestcrapfloodcrapgame
craphatcrapheadcrapholecraphouse
crapingcraploadcrapmobilecrapnel
crapolacrappercrappiecrappily
crappinesscrappitycrapplecrapplet
crappocrappycrapscrapshoot
crapshootercrapstormcraptacularcraptastic
craptasticalcraptexcrapulacrapule
crapulencecrapulentcrapulentallcrapulous
crapulouslycrapulousnesscrapwarecrapy
craquelurecrarecrascrase
crashcrash and burncrash barriercrash box
crash cartcrash coursecrash cymbalcrash diet
crash divecrash gearboxcrash helmetcrash hot
crash landcrash landingcrash locator beaconcrash out
crash padcrash position indi…crash programcrash programme
crash rescue and fi…crash spacecrash testcrash test dummy
crash trolleycrash-divecrash-helmetcrash-land
crashablecrashawcrashaw, richardcrashdump
crashedcrashercrashingcrashingly
crashlesscrashlikecrashlyticscrashpad
crashproofcrashworthinesscrashworthycrashy
crasiscraspediacraspedotacraspedote
crasscrassamentcrassamentumcrassiment
crassitudecrasslycrassnesscrassostrea
crassulacrassula ovatacrassulaceaecrassulacean
crassuscrassus, lucius lic…crassus, marcus lic…crastination
cratcrataeguscrataegus aestivaliscrataegus apiifolia
crataegus biltmorea…crataegus calpodend…crataegus coccineacrataegus coccinea …
crataegus crus-gallicrataegus laevigatacrataegus marshalliicrataegus mollis
crataegus monogynacrataegus oxyacanthacrataegus oxycanthacrataegus pedicella…
crataegus tomentosacratchcratecrated
cratefulcrateloadcratercrater face
crater lakecrater lake nationa…crater moundcratered
crateriformcratering chargecraterlesscraterlet
craterlikecraterostigmacraterouscraters of the moon
cratescratevacratingcratinus
cratippuscratippus of athenscratolagniacratology
cratoncratoniccraturcratureless
cratyluscraugastor augusticraunchcraunched
craunchingcravatcravattedcrave
cravedcravencravenedcravenette
craveningcravenlycravennesscraver
cravingcravingnesscrawcrawdad
crawdaddycrawdaddy!crawfishcrawfish out
crawfordcrawford and balcar…crawford, marioncrawford, thomas
crawforditecrawkcrawlcrawl in
crawl spacecrawl withcrawlablecrawled
crawlercrawlerwaycrawleycrawling
crawling back to youcrawling horrorcrawlspacecrawly
craxcraycrayecrayer
crayer, caspar decrayettecrayfishcrayfisher
crayfishermancrayfisherycrayolacrayon
crayonedcrayoningcrayonlikecraythur
crayturcrazecraze-millcrazed
crazedlycrazednesscrazilycraziness
crazingcrazing-millcrazycrazy bitch
crazy bonecrazy eightscrazy eyescrazy glue
crazy golfcrazy horsecrazy housecrazy like a fox
crazy pavingcrazy quiltcrazy weedcrazy-ass
crazyweedcrccrc handbookcré
creablecreacionismocreaghtcreak
creakedcreakilycreakinesscreaking
creakinglycreakle, mr.creakycream
cream cakecream cheesecream corncream cracker
cream crackeredcream in ones jeanscream laidcream of tartar
cream of the cropcream of wheatcream offcream pie
cream pitchercream puffcream saucecream soda
cream teacream upcream violetcream-colored
cream-colored cours…cream-facedcream-fruitcream-of-tartar tree
cream-slicecream-whitecreamcakecreamcups
creamedcreamed corncreamercreameries
creamerycreamilycreaminesscreaming
creamlesscreamlikecreampiecreamsicle
creamwarecreamycreancecreant
creasecrease-resistantcreasedcreaseless
creaseproofcreasercreaseyitecreashak
creasingcreasotecreasycreasy, sir edward
creatcreatablecreatecreate (dc)
create by mental actcreate from raw mat…create from raw stu…create mentally
create verballycreate, read, updat…createdcreated by
createscreaticcreatincreatine
creatine kinasecreatine kinase, bb…creatine kinase, mb…creatine kinase, mi…
creatine kinase, mm…creatine phosphatecreatine phosphoric…creating
creating by mental …creating by removalcreating from raw m…creating one flesh
creatinincreatininasecreatininecreation
creation sciencecreationalcreationarilycreationary
creationismcreationistcreationisticcreativasc medical
creativecreative accountingcreative activitycreative allies
creative artists ag…creative brain stud…creative circle adv…creative citizen
creative commonscreative commons li…creative destructioncreative differences
creative energycreative personcreative skillsetcreative thinker
creative thinkingcreative workcreative writingcreativelive
creativelycreativenesscreativitycreator
creatorlesscreatorlikecreatorscreatorship
creatresscreatrixcreaturalcreature
creature comfortcreature comfortscreature featurecreaturedom
creaturelesscreaturelikecreaturelinesscreaturely
creaturescreatures of habitcreatureshipcreaturize
creazecrebcreb-binding proteincrébillon
crebricostatecrebrisulcatecrebritudecrebrous
crechecrécycredcredal
credant technologiescredecredencecredence table
credendacredendumcredentcredential
credentialedcredentialingcredentialismcredentialization
credentialscredenzacrederitycredibility
credibility gapcrediblecrediblenesscredibly
creditcredit accountcrédit agricole co…credit analyst
credit applicationcredit bureaucredit cardcredit card fraud
credit card tartcredit crunchcredit default opti…credit default swap
credit entrycredit eventcrédit fonciercredit history
credit hourcredit limitcredit linecredit mobilier
credit notecredit ordercredit ratingcredit reference
credit reportcredit riskcredit scorecredit score in the…
credit sesamecredit sidecredit systemcredit transfer
credit unioncredit-deposit ratiocreditabilitycreditable
creditablenesscreditablycreditedcrediting
creditlesscréditocreditorcreditor's rights
creditors rightscreditresscreditrixcredits
creditworthinesscreditworthycredneritecredo
credobaptistcredophilecredoraxcredulitiveness
credulitycredulouscredulouslycredulousness
creecreech, kentuckycreech, williamcreed
creedalcreeditecreedlesscreedmore
creedscreekcreek bedcreek confederacy
creekfishcreekfrontcreekologycreeks
creeksidecreekwatercreekycreel
creelercreemcreepcreep feed
creep increep intocreep jointcreep someone out
creep upcreep up oncreepagecreeper
creepethcreepholecreepiecreepify
creepilycreepinesscreepingcreeping barrage
creeping bellflowercreeping bentcreeping bentgrasscreeping bugle
creeping buttercupcreeping charliecreeping crowfootcreeping elegance
creeping featurismcreeping featuritiscreeping ferncreeping jenny
creeping junipercreeping lilycreeping minecreeping oxalis
creeping snowberrycreeping soft grasscreeping spike rushcreeping st john's …
creeping thistlecreeping thymecreeping willowcreeping windmill g…
creeping wintergreencreeping wood sorrelcreeping zinniacreepingly
creeplecreepmetercreepscreepy
creepy-crawliescreepy-crawlycreepy-peepycrees
creesecreftingcreighton, mandellcrema
cremaillerecremainscremastercremasteric
crematecremationcremation chambercremationist
crematorcrematorialcrematoriescrematorium
crematoriumscrematorycremecreme anglais
creme bruleecreme caramelcreme de cacaocreme de fraise
creme de menthecrème fraîchecrémieuxcremo, west virginia
cremocarpcremonacremorcremorne
cremosincremscremulatorcrenarchaeal
crenarchaeoncrenarchaeotacrenarchaeotalcrenarchaeote
crenatecrenate leafcrenatedcrenation
crenaturecrenelcrenelatecrenelated
crenelated moldingcrenelatingcrenelationcrenellate
crenellatedcrenellated mouldingcrenellationcrenelle
crenelledcrenglecrenic acidcrenkle
crenotherapycrenshawcrenulatecrenulated
crenulationcreocreodontcreole
creole statecreole-fishcreoleancreolian
creolincreolizationcreolizecreon
creopointcreosolcreosotecreosote bush
creosotedcreosotelikecreosotingcrep
crepancecrepanecrepecrepe de chine
crepe ferncrepe flowercrepe gardeniacrepe jasmine
crepe marocaincrepe myrtlecrepe papercrepe rubber
crepe suzettecrepelikecreperiecrepey
crepidomacrepiscrepitantcrepitate
crepitatedcrepitatingcrepitationcrepitation rale
crepitouscrepituscreponcrept
crepusclecrepuscularcrepuscular raycrepuscularity
crepuscularlycrepusculecrepusculinecrepusculous
crepusculumcrépy, aisnecreraritecres
crescencecrescendocrescendo biosciencecrescent
crescent citycrescent mooncrescent rollcrescent unmanned s…
crescent-cell anaem…crescent-cell anemiacrescent-shapedcrescentia
crescentia cujetecrescenticcrescentinicrescentius
crescentwisecrescivecrescocrescograph
cresolcresolatecresorcincrespelle
crespi, giuseppecrespinecrespocress
cress greencress plantcressellecresses
cressetcressidacresslikecresson
cressycrestcrest cloudcrest syndrome
crestatechcrestedcrested cariamacrested coral root
crested larkcrested mynacrested penguincrested screamer
crested swiftcrested titcrested wheat grasscrested wheatgrass
crestfallencrestiecrestingcrestless
crestless wavecrestmontcrestone telecomcreswell
creswell, sir cresw…creswick, thomascresylcresylic
creta, oklahomacretaceancretaceouscretaceous period
cretaceouslycretaciouscretancretan dittany
cretecrete dittanycretiancretic
creticismcretincretinisecretinism
cretinizecretinoidcretinouscretism
cretonnecretorcretosecreusa
creusecreusot, lecreutzercreutzfeldt-jakob d…
creutzfeldt-jakob s…creutzfeldt–jakob…creuxcreuzer
crevallecrevalle jackcrevantcrevasse
crèvecœurcrevetcrevicecrevice corrosion
crevicedcreviscrewcrew chief
crew cutcrew membercrew neckcrew neckline
crew sockcrew-served weaponcrewcutcrewe
crewedcrewelcrewelworkcrewer
crewetcrewlesscrewmancrewmate
crewmembercrewneckcrewneckedcrex
crex crexcrfscrgcri de coeur
cri de coeur*cri du chat syndromecri technologiescri-du-chat syndrome
criacribcrib boardcrib death
crib mattresscrib notecrib sheetcrib-biter
crib-bitingcribbagecribbage boardcribbed
cribbercribbingcribblecribbled
cribblingcribellumcribercriblike
cribratecribrationcribriformcribriform plate
cribrosecribrouscriccricetid
cricetidaecricetinaecricetuluscricetus
cricetus cricetuscrichtoncrichton, jamescrichtonite
cricifycrickcricketcricket ball
cricket batcricket equipmentcricket fieldcricket frog
cricket groundcricket matchcricket pitchcricket whites
cricket-bat willowcricketercricketingcricketless
cricketscricketycricoidcricoid cartilage
cricondenthermcricothyroidcricothyroidotomycriddleite
criedcrieffcriercries
criestcrigancrigler-najjar synd…crigler–najjar sy…
crikeycrilecrilloncrim
crimblecrimbocrimecrime against human…
crime against naturecrime analysiscrime and punishmentcrime fiction
crime lordcrime of passioncrime preventioncrime prevention th…
crime ratecrime scenecrime statisticscrime syndicate
crime victimscrime wavecrime-riddencrimea
crimea-congo hemorr…crimeancrimean peninsulacrimean tatar
crimean warcrimebustercrimebustingcrimefighter
crimefightingcrimefreecrimefulcrimeless
crimelikecrimereportscrimeriddencrimes
crimes against huma…crimethinc.crimethinkcrimeware
crimewatch uscrimewavecrimidinecriminal
criminal activitycriminal citationcriminal congresscriminal contempt
criminal conversati…criminal courtcriminal intelligen…criminal intent
criminal investigat…criminal justicecriminal lawcriminal negligence
criminal offencecriminal possessioncriminal procedurecriminal prosecution
criminal psychologi…criminal psychologycriminal recordcriminal suit
criminalisationcriminalisecriminalismcriminalist
criminalisticscriminalitycriminalizationcriminalize
criminallycriminalnesscriminaloidcriminals
criminatecriminatedcriminatingcrimination
criminativecriminatorycriminicriminogenically
criminol.criminologicalcriminologistcriminology
criminouscriminousnesscriminycrimosin
crimpcrimpagecrimpedcrimper
crimpingcrimplecrimpledcrimpling
crimpnesscrimpycrimsoncrimson clover
crimson glorycrimson hexagoncrimson informaticscrimsoned
crimsoningcrimsonlycrimsonnesscrinal
crinan canalcrinatedcrinatorycrincum
crincum-crancumcrinedcrinelcrinet
cringecringelingcringemakingcringer
cringeworthycringingcringinglycringingness
cringlecringycriniculturalcriniere
crinigerouscrinioncrinitalcrinite
crinitorycriniviruscrinklecrinkle root
crinkle-rootcrinkledcrinklerootcrinkliness
crinklingcrinklycrinkycrinoid
crinoidalcrinoideacrinoideancrinoline
crinolinedcrinosecrinositycrinum
crioboliumcriollocriollo peoplecriosphinx
crioulocripcripescripple
cripple creekcrippledcrippled insidecrippleness
cripplercripplewarecripplingcripplingly
cripplycripscriptcrisco
crisescrisiscrisis action plann…crisis center
crisis interventioncrisis managementcrisis negotiationcrisis-ridden
crispcrisp breadcrispatecrispated
crispationcrispaturecrispbreadcrisped
crispencrispercrisphead lettucecrispi, francesco
crispilycrispincrispin and crispin…crispiness
crispingcrisplycrispnesscrisps
crispuscrispus attucks: a …crispycrispy gamer
crispy!criss crosscriss-crosscriss-cross applesa…
crissacrissalcrisscrosscrisscross heart
crisscross-rowcrisscrossedcrissumcrist
cristacristalcristalinacristallo
cristallologycristatecristiano ronaldocristina
cristo redentorcristobalcristobal balenciagacristóbal carbine
cristobal coloncristobalitecristoforo colombocrit
crit.critchfieldcriteriacriterial
criterioncriterionalcriterionlesscriterions
criteriorcriteriumcrithcrithidia
crithidia fascicula…crithomancucrithomancycritias
criticcriticalcritical acclaimcritical analysis
critical anglecritical appraisalcritical assetcritical asset list
critical capabilitycritical carecritical conditioncritical control po…
critical diagnosticscritical discourse …critical enginecritical function
critical illnesscritical informationcritical infrastruc…critical infrastruc…
critical inquirycritical intelligen…critical itemcritical item list
critical joint duty…critical literacycritical masscritical media
critical micelle co…critical occupation…critical opalescencecritical path
critical path methodcritical pathwayscritical periodcritical period (ps…
critical pointcritical practicecritical rationalismcritical requirement
critical reviewcritical reynolds n…critical sectioncritical speed
critical supplies a…critical sustainabi…critical technologi…critical theory
critical thinkingcritical tide levelcritical updatecritical value
critical vulnerabil…criticalitycriticality assessm…critically
critically acclaimedcriticalmetricscriticalnesscriticaster
criticisablecriticisecriticisedcriticiser
criticisingcriticismcriticisms of globa…criticizable
criticizationcriticizecriticizercriticizingly
criticocriticproofcriticscritique
critique^itcrititechcritoncritter
critter sittercrittercismcritterscrius
crix labscrixivancrizzelcrizzle
crizzledcrk-associated subs…crlfcrm software
crna goracrngedcrocroûte
cro-magnoncro-quettecroaghcroak
croakedcroakercroakingcroaky
croatcroatiacroatiancroatian peasant pa…
croatian sheepdogcroato-serbiancroatscroa`tia and slavon…
croccrocacincrocanthemum canade…croce
croceincroceouscrocethiacrocethia alba
crocetincrochecrochetcrochet hook
crochet needlecrochet stitchcrochetedcrocheter
crochetingcrochetworkcrochucrociary
crocidolitecrocincrockcrock of gold
crock of shitcrock potcrock upcrocked
crockercrockerscrockerycrocket
crocketedcrocketingcrockettcrockett, samuel ru…
crockingcrockpotcrockycrocodile
crocodile birdcrocodile clipcrocodile rivercrocodile tear
crocodile tearscrocodilelikecrocodilescrocodilia
crocodiliancrocodilian reptilecrocodilitycrocodilus
crocodoccrocodyliacrocodylidaecrocodyliform
crocodylomorphcrocodyluscrocodylus niloticuscrocodylus porosus
crocoisitecrocoitecrocolitecroconate
croconazolecroconiccroconic acidcrocose
crocosmiacrocottacrocscrocus
crocus sativuscrocus technologycrocuslikecrocuta
crocuta crocutacroesuscroftcrofter
croftingcroftlandcrohncrohn disease
crohn's diseasecrohns diseasecroirecrois
croisadecroisadocroisecroissant
croissantecroissantlikecrois\u00e9croix de guerre
crokercroker, john wilsoncroker, t. croftoncroll, james
croly, georgecromcromacromagnon
cromakalimcromarcromartycrome
crome, johncromlechcromniomancycromoglicate
cromoglicic acidcromoglycatecromolyncromolyn sodium
cromornacromornecromptoncrompton urban dist…
crompton, samuelcromulentcromwellcromwell (oliver)
cromwell, olivercromwell, richardcromwell, thomascromwellian
cronartiumcronartium ribicolacronecronel
cronelikecronenbergiancronetcronian
croniescronkcronocronote
cronstadtcronstedtitecrontabcronus
cronusitecronycronyismcronyistic
croo monkeycroodlecrookcrook and nanny
crookackcrookbackcrookbackedcrookbill
crookedcrooked-stemmed ast…crookedlycrookedness
crookencrookerycrookescrookes radiometer
crookes tubecrookes, williamcrookesitecrooking
crookneckcrookneck squashcrookscroon
croonedcroonercrooningcroony
cropcrop circlecrop failurecrop out
crop protectioncrop residuecrop rotationcrop top
crop upcrop venturescrop-dustingcrop-ear
crop-earedcrop-tailedcropboundcropduster
cropecropfulcroplandcroplands
croplikecroppablecroppedcropper
croppingcrops, agriculturalcropsickcropup
croque-madamecroque-monsieurcroquembouchecroquet
croquet ballcroquet equipmentcroquet malletcroqueta
croquetedcroquetingcroquetlikecroquette
croquiscrorecrorepaticrosby
croscarmellosecrosiercrosieredcroslet
crosnecrospovidonecrosscross a bridge befo…
cross batcross bitcross buncross channel
cross checkcross circulationcross compilercross connection
cross countrycross cover versioncross creekcross crosslet
cross dressingcross examinationcross examinecross fell
cross firecross florycross haircross hairs
cross infectioncross junctioncross matchingcross merchandising
cross multiplycross of calvarycross of goldcross of gold speech
cross of lorrainecross offcross one's eyescross one's fingers
cross ones armscross ones fingerscross ones heartcross oneself
cross outcross overcross pathscross patt\u00e9e
cross peen hammercross pixel mediacross postcross product
cross protectioncross purposecross purposescross question
cross reactionscross referencecross roadscross sea
cross sectioncross someones palmcross someones pathcross street
cross swordscross tabcross tabulationcross talk
cross tellcross that bridge w…cross the aislecross the floor
cross the linecross the rubiconcross thwartcross vine
cross windcross wirecross, mrs.cross, southern
cross, victoriacross-cross-actioncross-armed
cross-bandedcross-bearercross-beddingcross-bench
cross-benchercross-birthcross-bordercross-bred
cross-breedcross-breedingcross-browsercross-bun
cross-capcross-channelcross-checkcross-classification
cross-compatiblecross-connecting bo…cross-console emula…cross-contaminate
cross-contaminationcross-correlationcross-countrycross-country jumpi…
cross-country ridingcross-country skiingcross-cousincross-crosslet
cross-culturalcross-cultural comp…cross-cuttingcross-days
cross-divisioncross-dockingcross-dresscross-dresser
cross-dressingcross-examinationcross-examinecross-examined
cross-examinercross-examiningcross-eyecross-eyed
cross-fertilecross-fertilisationcross-fertilisecross-fertilization
cross-fertilizecross-filecross-firecross-foster
cross-fosteringcross-garnetcross-grainedcross-index
cross-infectioncross-jack yardcross-lagcross-leaved heath
cross-leggedcross-levelingcross-lightcross-linguistic
cross-linguisticallycross-linkcross-linkagecross-linked
cross-linking reage…cross-loading (pers…cross-magnetizing e…cross-modal
cross-multiplicationcross-multiplycross-over blockcross-over studies
cross-partycross-patchcross-pawlcross-phrasing
cross-platformcross-plycross-pollinatecross-pollinating
cross-pollinationcross-primingcross-purposecross-question
cross-questionedcross-questionercross-questioningcross-ratio
cross-reactcross-reactioncross-reactivitycross-reading
cross-refercross-referencecross-resistancecross-section
cross-sectionalcross-sectional stu…cross-sellcross-selling
cross-sententialcross-servicingcross-shapedcross-spale
cross-spallcross-springercross-staffcross-stitch
cross-stitchercross-stonecross-tabcross-tail
cross-targeting (nu…cross-tiecross-tiningcross-tolerance
cross-towncross-traincross-trainingcross-trees
cross-validationcross-vaultingcross-weekcrossband
crossbandingcrossbarcrossbarredcrossbeak
crossbeamcrossbeam systemscrossbenchcrossbencher
crossbenchescrossbillcrossbitecrossbody
crossbonescrossborderscrossbowcrossbow technologi…
crossbowercrossbowmancrossbracingcrossbred
crossbreedcrossbreedercrossbreedingcrossbuck
crosscheckcrosschxcrossclaimcrossclass
crosscorrelationcrosscoupledcrosscouplingcrosscourt
crosscurrentcrosscutcrosscut sawcrosscutting
crossecrosse, andrewcrossectionalcrossed
crossed eyecrossed fingerscrossed loop sensorcrossed out
crossercrossettecrosseyedcrossfade
crossfadercrossfeedcrossfibercrossfield
crossfirecrossfirst bankcrossfishcrossflow
crossgendercrossgradecrossgrainedcrossguard
crosshaircrosshairscrosshatchcrosshatched
crosshatchingcrossheadcrossheadingcrossing
crossing areacrossing automationcrossing guardcrossing number
crossing overcrossing over, gene…crossing the linecrossing wires
crossingscrossjackcrossleggedcrosslet
crosslicensecrosslightcrosslikecrosslinear
crosslinearlycrosslinguisticcrosslinkcrosslinker
crossloadcrossloopcrosslotscrossly
crossmatchcrossmatchedcrossmembercrossmetathesis
crossnathcrossnationalcrossnesscrossopterygian
crossopterygiicrossovercrossover dribblecrossover health ma…
crossover votecrossover votercrossoverscrosspatch
crosspiececrosspipecrossplaycrossplayer
crosspointcrosspostcrosspostercrossraguel
crossrangecrossreactcrossreactioncrossreactive
crossrefcrossroadcrossroadscrossroads systems
crossrowcrossruffcrosstabcrosstalk
crosstiecrosstowncrosstreecrosstrees
crosstxcrosswalkcrosswaycrossways
crossways, dorsetcrosswindcrosswisecrossword
crossword (puzzle)crossword puzzlecrosswordlikecrossworld warranty
crosswortcrostatacrostinicrotal
crotalariacrotalaria sagitall…crotalaria spectabi…crotalid venoms
crotalidaecrotalinecrotalocrotalum
crotaluscrotalus adamanteuscrotalus atroxcrotalus cerastes
crotalus horridus a…crotalus horridus h…crotalus lepiduscrotalus mitchellii
crotalus scutulatuscrotalus tigriscrotalus viridiscrotamiton
crotanaldehydecrotaphioncrotaphitecrotaphitic
crotaphytuscrotchcrotch fruitcrotch hair
crotch rocketcrotch, williamcrotchedcrotches
crotchetcrotchet restcrotchetedcrotchetiness
crotchetycrotchlesscrotenaycroton
croton bugcroton eluteriacroton oilcroton tiglium
crotonacrotonaldehydecrotonamidecrotonate
crotonatescrotonbugcrotonecrotonic
crotonic acidcrotonic acidscrotoninecrotonylene
crotophagacrotoxincrottalcrottle
crottlescrotylcrotylationcrotylboration
crouchcrouch downcrouchedcroucher
crouchingcroudcroukecroup
croupadecroupalcroupecrouper
croupiercroupier's rakecroupierecroupiness
croupouscroupycrousecrouseilles
croustadecroutcroutoncrouzon syndrome
crowcrow blackbirdcrow corncrow garlic
crow pheasantcrow pointcrow scarercrow step
crow's feetcrow's footcrow's nestcrow's-feet
crow's-footcrow's-nestcrow-baitcrow-quill
crow-silkcrow-troddencrowbaitcrowbar
crowbar hotelcrowberrycrowberry familycrowd
crowd artcrowd catchcrowd controlcrowd into
crowd outcrowd playcrowd sciencecrowd supply
crowd surfercrowd surfingcrowd technologiescrowd together
crowd upcrowd-poisoningcrowdboostercrowdcast
crowdcompasscrowdcomputing syst…crowdedcrowdengineering
crowdercrowderscrowdfeedcrowdflik
crowdflowercrowdfundercrowdfundingcrowdgather
crowdhallcrowdiecrowdingcrowdlike
crowdlycrowdmedcrowdmobcrowdoptic
crowdpleasercrowdrisecrowdscrowdsling
crowdsourcecrowdsourcedcrowdsourcingcrowdspring
crowdstarcrowdstrikecrowdtapcrowdtilt
crowdtwistcrowdvancecrowdycrowdzone
crowdzucrowe, eyre evanscrowe, sir james ar…croweater
crowedcrowflowercrowfootcrowfoot family
crowfoot grasscrowingcrowkeepercrowley
crowleyancrowlikecrowncrown attorney
crown beardcrown biosciencecrown cactuscrown colony
crown compoundscrown courtcrown daisycrown estate
crown ethercrown etherscrown firecrown flower
crown gallcrown glasscrown graftingcrown green
crown green bowlscrown imperialcrown in towncrown jewel
crown jewelscrown landcrown lengtheningcrown lens
crown mammalcrown moldingcrown monkeycrown of thorns
crown officecrown pointcrown princecrown princess
crown roastcrown sawcrown sidecrown vetch
crown viccrown wardcrown wartcrown wheel
crown-beardcrown-imperialcrown-of-the-fieldcrown-post
crown-rump lengthcrown-sawcrownbeardcrowne, john
crownedcrowned cranecrowned headcrowned pigeon
crownedstcrownercrownetcrowning
crownlesscrownletcrownlikecrownpeak
crownpiececrownscrownworkcrows
crows feetcrows footcrows nestcrowstep
crowstonecrowthcrowther, samuel ad…crowtoe
croycroydoncroydon faceliftcroylstone
croyncroyscrozecroze iron
croziercrozieredcrpcrs reprocessing se…
crtcrt screencrtscru
crubeenscrucescruces, cubacrucial
crucialitycruciallycruciancrucian carp
cruciatecruciate sulcuscruciationcrucible
crucible steelcrucible, electriccrucifercruciferae
cruciferouscruciferous plantcruciferous vegetab…crucified
crucifiercrucifixcrucifix fishcrucifixes
crucifixioncrucifixionlikecrucifixlikecruciform
crucifycrucifyingcrucigerouscruciverbalism
cruciverbalistcruckcrudcruddiness
cruddlecruddycrudecrude oil
crude sapcrude-oilcrudelycruden, alexander
crudenesscruditéscruditiescrudity
crudlecrudoscrudwarecrudy
cruelcruel and unusual p…cruel plantcruella de vil
cruellycruelnesscruelscruelties
crueltycruentarencruentatecruentous
cruetcruet-standcruftcruft together
cruftscruftsmanshipcruftycruikshank
cruikshank, georgecruiscruisecruise control
cruise linecruise linercruise missilecruise ship
cruisedcruiselikecruisercruiserweight
cruisewearcruisewisecruisingcruising altitude
cruising levelcruisycruivecrull
crullercrumcrumbcrumb cake
crumb downcrumbclothcrumbedcrumber
crumbilycrumbinesscrumbingcrumblable
crumblecrumbledcrumblercrumbless
crumbletcrumblikecrumblinesscrumbling
crumblinglycrumblingscrumblycrumbs
crumbumcrumbycrumcakecrumenal
crumhorncrummablecrummilycrumminess
crummockcrummycrumpcrumpet
crumpinesscrumplecrumple zonecrumpled
crumplednesscrumplercrumplingcrumply
crumpycrunchcrunch numberscrunch time
crunchablecrunchedcrunchercrunchiness
crunchingcrunchinglycrunchycrunchyroll
crunkcrunklecrunodalcrunode
cruorcruorincrupcrupper
cruracruralcrurophiliacrurotarsal
cruscrusadecrusadedcrusader
crusaderlikecrusaderscrusadescrusades, the
crusadingcrusadocrusecruse, illinois
crusetcrushcrush hatcrush on
crush on youcrush outcrush partycrush room
crush syndromecrushablecrushblvdcrushed
crushed leathercrushed rockcrushed sugarcrushee
crushercrusher gaugecrushingcrushingly
crushpathcrushproofcrusoe, robinsoncrust
crustacrustaceacrustaceancrustacean larvae
crustaceologicalcrustaceologistcrustaceologycrustaceous
crustaceousnesscrustalcrustal movementcrustal plate
crustalogicalcrustalogistcrustalogycrustated
crustationcrustedcrustiecrusties
crustificcrustilycrustinesscrusting
crustlesscrustlikecrustosecrustose thallus
crustquakecrustycrutcrutch
crutchedcrutchescrutchlikecruth
cruttercruxcrux australiscrux biomedical
crux gammatacrux of the mattercrux simplexcruxes
cruyff turncruz recordscruzacruzado
cruzadoscruzancruzeirocruzeiro da fortale…
cruzeiro do oestecruzeiro do sulcrwthcry
cry all the way to …cry babycry blue murdercry down
cry forcry for helpcry havoccry in ones beer
cry like a babycry like a little g…cry me a rivercry off
cry ones eyes outcry outcry out againstcry out for
cry someone a rivercry the bluescry unclecry uncle!
cry wolfcry-babycry-baby treecryaesthesia
cryalcrybabycrybaby treecryer
cryesthesiacryin'cryingcrying bird
crying callcrying shamecryo-cryo-electron micro…
cryo-transmissioncryo-transmission e…cryoablationcryoactivation
cryoanaesthesiacryoanesthesiacryobenchcryobiological
cryobiologistcryobiologycryobiosiscryobiotic
cryobuffercryocardioplegiacryocauterycryochrept
cryocondensationcryoconitecryocooledcryocooler
cryocoolingcryocrystallographycryodetectorcryoelectron
cryoelectron micros…cryoelectroncscryoelectroniccryoelectronics
cryofixationcryofixedcryofocuscryofocusing
cryogencryogenesiscryogeniancryogenic
cryogenic liquidcryogenicallycryogenicscryogenine
cryogenycryoglobulincryoglobulinemiacryoglobulins
cryohydratecryohydriccryokinesiscryolathe
cryolitecryolithionitecryoliticcryomagnetic
cryometercryometriccryometrycryomicrograph
cryomicroscopiccryomicroscopycryomodulecryonic
cryonicscryopathycryopelagiccryophilic
cryophobiacryophoruscryophysicscryophyte
cryoplanktoncryoportcryoprecipitatecryopreservation
cryopreservecryopreservedcryopreservingcryoprobe
cryoprotectcryoprotectedcryoprotectioncryoprotective agen…
cryopumpcryopyrincryopyrin-associate…cryoregime
cryosamplingcryoscopecryoscopiccryoscopy
cryosectioncryosectionedcryosectioningcryosleep
cryosolventcryospherecryosphericcryostasis
cryostatcryostaticcryosurgeoncryosurgery
cryosurgicalcryosurgicallycryotechnologycryotemperature
cryotherapistcryotherapycryotomographiccryotomography
cryotrapcryotrappingcryotroncryoturbation
cryoultramicrotomycryovialcryovolcaniccryovolcanism
cryovolcanocryoxtract instrume…cryppiecrypsis
cryptcryptacanthodescryptacanthodes mac…cryptal
cryptanalysiscryptanalystcryptanalyticcryptanalytics
cryptandcryptarithmcryptatecryptic
cryptic colorationcryptic crosswordcrypticalcryptically
crypticitycryptidcryptidinecryptlike
cryptocrypto-crypto-fascismcrypto-fascist
crypto-fascisticcrypto-revisionismcryptobiontcryptobiosis
cryptobioticcryptobranchiatacryptobranchiatecryptobranchidae
cryptobranchuscryptobranchus alle…cryptocaryacryptocercidae
cryptocercuscryptochannelcryptochiralcryptochirality
cryptochromecryptochromescryptococcalcryptococcosis
cryptococcuscryptococcus gattiicryptococcus neofor…cryptocoryne
cryptocracycryptocrystallinecryptodepressioncryptoexotic
cryptogamcryptogamecryptogamiacryptogamiae
cryptogamiancryptogamiccryptogamistcryptogamous
cryptogeniccryptogenic organiz…cryptogenic speciescryptogram
cryptogrammacryptogramma acrost…cryptogramma crispacryptogrammataceae
cryptogrammaticcryptogrammaticallycryptogramscryptograph
cryptographalcryptographercryptographiccryptographic infor…
cryptographicalcryptographicallycryptographistcryptography
cryptohalitecryptolaliacryptolectcryptolepis
cryptologiccryptologicalcryptologistcryptology
cryptomariacryptomaterialcryptomelanecryptomeria
cryptomeria japonicacryptomnesiacryptomodulecryptomonad
cryptomorphiccryptomorphismcryptoncryptonephridial
cryptonymcryptonymiccryptopartcryptophane
cryptophonecryptophthalmoscryptophyceaecryptophyta
cryptophytecryptopinecryptoporticuscryptoprocessing
cryptoprocessorcryptoproctacryptoprocta feroxcryptorchid
cryptorchidismcryptorchidycryptorchismcryptospora
cryptosporidiidaecryptosporidiosiscryptosporidiumcryptosporidium par…
cryptosystemcryptotermescryptotermes breviscryptotis
cryptotis parvacryptotomographycryptoxanthincryptozoological
cryptozoologistcryptozoologycrypturicrystal
crystal ballcrystal clearcrystal countercrystal detector
crystal gazingcrystal healingcrystal iscrystal lattice
crystal methcrystal microphonecrystal momentumcrystal oscillator
crystal pickupcrystal pleatcrystal radiocrystal rectifier
crystal setcrystal structurecrystal teacrystal twinning
crystal violetcrystal-clearcrystalgenomicscrystalisation
crystalisecrystalisedcrystalizecrystalized
crystalliferouscrystallincrystallinecrystalline fructose
crystalline humourcrystalline lenscrystallinitycrystallins
crystallisationcrystallisecrystallisedcrystallite
crystallizabilitycrystallizablecrystallizationcrystallization, el…
crystallizecrystallizedcrystallized fruitcrystallized ginger
crystallizercrystallizingcrystallo-crystalloclast
crystallogenesiscrystallogeniccrystallogenicalcrystallogeny
crystallogeometricalcrystallographercrystallographiccrystallographical
crystallographicallycrystallographycrystallography, x-…crystalloid
crystallomancycrystallometrycrystallophonecrystallurgy
crystalluriacrystalplexcry_wolfcr\u00e8che
cr\u00e8me anglaisecr\u00e8me br\u00fb…cr\u00e8me caramelcr\u00e8me de cacao
cr\u00e8me de cassiscr\u00e8me de la cr…cr\u00e8me de menthecr\u00e8me fra\u00e…
cr\u00e9maill\u00e8…cr\u00eape de chinecr\u00eape papercr\u00eape suzette
cr\u00eapy   

The Web's Largest Resource for

Definitions & Translations


A Member Of The STANDS4 Network