Found 3,134 definitions starting with CR:

crcrêpesuzettecrèchecrème
crèmedecacaocrèmedecassiscrèmedelacr&…crèmedementhe
crèmefra&ici…crèvecoeurcr.cr/che
crabcrab applecrab boilcrab burger
crab cactuscrab canoncrab cocktailcrab grass
crab legscrab louiscrab lousecrab mentality
crab nebulacrab rangooncrab spidercrab tree
crab-eatercrab-eating dogcrab-eating foxcrab-eating macaque
crab-eating opossumcrab-eating raccooncrab-eating sealcrab-plover
crab-yawscrabapplecrabapple jellycrabbe, george
crabbedcrabbedlycrabbednesscrabber
crabbilycrabbinesscrabbingcrabbish
crabbitcrabburgercrabbycrabby person
crabeatercrabeater sealcrabercrabfaced
crabgrasscrabletcrablikecrabmeat
crabronidcrabscrabsidlecrabstick
crabwisecrac!crachecracid
cracidaecrackcrack a bookcrack a crib
crack a fatcrack a smilecrack a smile... an…crack addict
crack babycrack cocainecrack downcrack down (on)
crack down oncrack ficcrack housecrack of dawn
crack of doomcrack oncrack ones fingerscrack onto
crack pipecrack rockcrack rootcrack seed
crack shotcrack throughcrack traincrack up
crack whorecrack willowcrack wisecrack-brained
crack-pipecrack-upcrackacrackable
crackbackcrackberrycrackbraincrackbrained
crackdowncrackedcracked tooth syndr…cracked wheat
cracked-wheat breadcrackednesscrackercracker bonbon
cracker boxcracker crumbscracker jackcracker jacks
cracker-barrelcrackerberrycrackerboxcrackerjack
crackerlesscrackerlikecrackerscrackhead
crackhousecrackingcracking upcrackle
crackle chinacrackle – the bes…crackleberrycrackled
cracklescracklewarecracklikecrackling
cracklinglycracklingscracklinscrackly
cracknelcrackowcrackpipecrackpot
crackpotterycrackproofcrackscracksman
cracksmencracktivismcracktrocrackup
crackwhorecrackycracky wagoncracovian
cracoviennecracowcracowescracticidae
cracticinaecracticuscradd signaling ada…cradgedness
cradlecradle capcradle catholiccradle mountain
cradle of civilizat…cradle robbercradle snatchercradle technologies
cradle-to-cradle de…cradle-to-gravecradleboardcradled
cradlelikecradlesongcradlingcraft
craft centrecraft faircraft unioncrafted
craftednesscraftercraftilycraftiness
craftlesscraftlikecrafts centrecraftsman
craftsmanlikecraftsmanlycraftsmanshipcraftsmaster
craftsmencraftspersoncraftspersonshipcraftswoman
craftswomanshipcraftsycraftworkcraftworker
craftycragcragfastcragged
craggednesscraggercraggilycragginess
craggycragscragsmancragsmen
craiccraiecraigcraig flounder
craig serani marshcraig ventnercraig, johncraig, sir thomas
craigenputtockcraigiecraigslistcraigslist inc.
craigslistercraigslistingcraikcraik, george little
craik, mrs.crailcraincraiova
craisincrakecrakeberrycraker
crakowcramcram downcram full
cram schoolcram sessioncram worldwidecram-full
crambecrambe maritimacrambe plantcrambe sponge
crambocrambucramdowncramer
cramer, johann bapt…cramlingtoncrammedcrammer
crammingcramoisiecramoisycramp
cramp ironcramp someones stylecrampbarkcramped
crampednesscrampetcrampfishcrampiness
crampingcrampitcramponcramponee
cramponscrampooncrampoonscramps
crampycramstercrancranach
cranach, lucascranachancranagecranapple
cranberriescranberrycranberry bushcranberry culture
cranberry heathcranberry juicecranberry morphemecranberry sauce
cranberry treecranberryingcranberrylikecrance
cranchcrandallitecranecrane fly
crane's billcrane's-billcrane, ichabodcrane, walter
crane-drivercranedcraneflycranelike
cranescranesbillcrangcrangon
crangonidaecranhamcraniacranial
cranial cavitycranial fontanellescranial fossa, ante…cranial fossa, midd…
cranial fossa, post…cranial indexcranial irradiationcranial nerve
cranial nerve disea…cranial nerve injur…cranial nerve neopl…cranial nerves
cranial orbitcranial sinusescranial suturescranially
craniatacraniatecranidiumcraniectomy
craningcraniocaudalcraniocerebral trau…cranioclasm
cranioclastcraniodentalcraniofacialcraniofacial abnorm…
craniofacial abnorm…craniofacial dysost…craniofaciallycraniognomy
craniologicalcraniologicallycraniologistcraniology
craniomandibularcraniomandibular di…craniometercraniometric
craniometric pointcraniometricalcraniometrycraniopagus
craniopharyngiomacraniosacralcranioscopistcranioscopy
craniosophiccraniosynostosescraniosynostosiscraniota
craniotomycranite systemscraniumcraniums
crankcrank anglecrank angle degreecrank call
crank handlecrank lettercrank outcrank science
crank upcrankbirdcrankcasecranked
crankilycrankinesscranklecrankness
crankpincrankscranksetcrankshaft
crankycranmercranmer, thomascrannied
cranniescrannockcrannogcrannoge
crannycrannyingcranstoncrant
crantaracrantscrapcrap artist
crap gamecrap on a stickcrap ones pantscrap out
crap shootingcrap upcrap-shootercrapaud
crapaud, jeancrapaudinecrapecrape fern
crape jasminecrape myrtlecrapedcrapefish
crapehangercrapelikecrapettecrapface
crapfestcrapfloodcrapgamecraphat
crapheadcrapholecraphousecraping
craploadcrapmobilecrapnelcrapola
crappercrappiecrappilycrappiness
crappitycrapplecrappletcrappo
crappycrapscrapshootcrapshooter
crapstormcraptacularcraptasticcraptastical
craptexcrapulacrapulecrapulence
crapulentcrapulentallcrapulouscrapulously
crapulousnesscrapwarecrapycraquelure
crarecrascrasecrash
crash and burncrash barriercrash boxcrash cart
crash coursecrash cymbalcrash dietcrash dive
crash gearboxcrash helmetcrash hotcrash land
crash landingcrash locator beaconcrash outcrash pad
crash position indi…crash programcrash programmecrash rescue and fi…
crash spacecrash testcrash test dummycrash trolley
crash-divecrash-helmetcrash-landcrashable
crashawcrashaw, richardcrashdumpcrashed
crashercrashingcrashinglycrashless
crashlikecrashlyticscrashpadcrashproof
crashworthinesscrashworthycrashycrasis
craspediacraspedotacraspedotecrass
crassamentcrassamentumcrassimentcrassitude
crasslycrassnesscrassostreacrassula
crassula ovatacrassulaceaecrassulaceancrassus
crassus, lucius lic…crassus, marcus lic…crastinationcrat
crataeguscrataegus aestivaliscrataegus apiifoliacrataegus biltmorea…
crataegus calpodend…crataegus coccineacrataegus coccinea …crataegus crus-galli
crataegus laevigatacrataegus marshalliicrataegus molliscrataegus monogyna
crataegus oxyacanthacrataegus oxycanthacrataegus pedicella…crataegus tomentosa
cratchcratecratedcrateful
crateloadcratercrater facecrater lake
crater lake nationa…crater moundcrateredcrateriform
cratering chargecraterlesscraterletcraterlike
craterostigmacraterouscraters of the mooncrates
cratevacratingcratinuscratippus
cratippus of athenscratolagniacratoncratonic
craturcraturelesscratyluscraugastor augusti
craunchcraunchedcraunchingcravat
cravattedcravecravedcraven
cravenedcravenettecraveningcravenly
cravennesscravercravingcravingness
crawcrawdadcrawdaddycrawdaddy!
crawfishcrawfish outcrawfordcrawford and balcar…
crawford, marioncrawford, thomascrawforditecrawk
crawlcrawl incrawl spacecrawl with
crawlablecrawledcrawlercrawley
crawlingcrawling back to youcrawling horrorcrawlspace
crawlycraxcraycraye
crayercrayer, caspar decrayettecrayfish
crayfishercrayfishermancrayfisherycrayola
crayoncrayonedcrayoningcrayonlike
craythurcrayturcrazecraze-mill
crazedcrazedlycrazednesscrazily
crazinesscrazingcrazing-millcrazy
crazy bitchcrazy bonecrazy eightscrazy eyes
crazy gluecrazy golfcrazy horsecrazy house
crazy like a foxcrazy pavingcrazy quiltcrazy weed
crazy-asscrazyweedcrccrc handbook
crécreablecreacionismocreaght
creakcreakedcreakilycreakiness
creakingcreakinglycreakle, mr.creaky
creamcream cakecream cheesecream corn
cream crackercream crackeredcream in ones jeanscream laid
cream of tartarcream of the cropcream of wheatcream off
cream piecream pitchercream puffcream sauce
cream sodacream teacream upcream violet
cream-coloredcream-colored cours…cream-facedcream-fruit
cream-of-tartar treecream-slicecream-whitecreamcake
creamcupscreamedcreamed corncreamer
creameriescreamerycreamilycreaminess
creamingcreamlesscreamlikecreampie
creamsiclecreamwarecreamycreance
creantcreasecrease-resistantcreased
creaselesscreaseproofcreasercreaseyite
creashakcreasingcreasotecreasy
creasy, sir edwardcreatcreatablecreate
create (dc)create by mental actcreate from raw mat…create from raw stu…
create mentallycreate verballycreate, read, updat…created
created bycreatescreaticcreatin
creatinecreatine kinasecreatine kinase, bb…creatine kinase, mb…
creatine kinase, mi…creatine kinase, mm…creatine phosphatecreatine phosphoric…
creatingcreating by mental …creating by removalcreating from raw m…
creating one fleshcreatinincreatininasecreatinine
creationcreation sciencecreationalcreationarily
creationarycreationismcreationistcreationistic
creativasc medicalcreativecreative accountingcreative activity
creative alliescreative artists ag…creative brain stud…creative circle adv…
creative citizencreative commonscreative commons li…creative destruction
creative differencescreative energycreative personcreative skillset
creative thinkercreative thinkingcreative workcreative writing
creativelivecreativelycreativenesscreativity
creatorcreatorlesscreatorlikecreators
creatorshipcreatresscreatrixcreatural
creaturecreature comfortcreature comfortscreature feature
creaturedomcreaturelesscreaturelikecreatureliness
creaturelycreaturescreatures of habitcreatureship
creaturizecreazecrebcreb-binding protein
crébilloncrebricostatecrebrisulcatecrebritude
crebrouscrechecrécycred
credalcredant technologiescredencecredence table
credendacredendumcredentcredential
credentialedcredentialingcredentialismcredentialization
credentialscredenzacrederitycredibility
credibility gapcrediblecrediblenesscredibly
creditcredit accountcrédit agricole co…credit analyst
credit applicationcredit bureaucredit cardcredit card fraud
credit card tartcredit crunchcredit default opti…credit default swap
credit entrycredit eventcrédit fonciercredit hour
credit limitcredit linecredit mobiliercredit note
credit ordercredit ratingcredit referencecredit report
credit riskcredit scorecredit score in the…credit sesame
credit sidecredit systemcredit transfercredit union
credit-deposit ratiocreditabilitycreditablecreditableness
creditablycreditedcreditingcreditless
créditocreditorcreditor's rightscreditors rights
creditresscreditrixcreditscreditworthiness
creditworthycredneritecredocredobaptist
credophilecredoraxcredulitivenesscredulity
credulouscredulouslycredulousnesscree
creech, williamcreedcreedalcreedite
creedlesscreedmorecreekcreek bed
creek confederacycreekfishcreekfrontcreekology
creekscreeksidecreekwatercreeky
creelcreelercreemcreep
creep feedcreep increep intocreep joint
creep someone outcreep upcreep up oncreepage
creepercreepethcreepholecreepie
creepifycreepilycreepinesscreeping
creeping barragecreeping bellflowercreeping bentcreeping bentgrass
creeping buglecreeping buttercupcreeping charliecreeping crowfoot
creeping elegancecreeping featurismcreeping featuritiscreeping fern
creeping jennycreeping junipercreeping lilycreeping mine
creeping oxaliscreeping snowberrycreeping soft grasscreeping spike rush
creeping st john's …creeping thistlecreeping thymecreeping willow
creeping windmill g…creeping wintergreencreeping wood sorrelcreeping zinnia
creepinglycreeplecreepmetercreeps
creepycreepy-crawliescreepy-crawlycreepy-peepy
creescreesecreftingcreighton, mandell
cremacremaillerecremainscremaster
cremastericcrematecremationcremation chamber
cremationistcrematorcrematorialcrematories
crematoriumcrematoriumscrematorycreme
creme anglaiscreme bruleecreme caramelcreme de cacao
creme de fraisecreme de menthecrème fraîchecrémieux
cremo, west virginiacremocarpcremonacremor
cremornecremosincremscremulator
crenarchaealcrenarchaeoncrenarchaeotacrenarchaeotal
crenarchaeotecrenatecrenate leafcrenated
crenationcrenaturecrenelcrenelate
crenelatedcrenelated moldingcrenelatingcrenelation
crenellatecrenellatedcrenellated mouldingcrenellation
crenellecrenelledcrenglecrenic acid
crenklecrenotherapycrenshawcrenulate
crenulatedcrenulationcreocreodont
creolecreole statecreole-fishcreolean
creoliancreolincreolizationcreolize
creoncreopointcreosolcreosote
creosote bushcreosotedcreosotelikecreosoting
crepcrepancecrepanecrepe
crepe de chinecrepe ferncrepe flowercrepe gardenia
crepe jasminecrepe marocaincrepe myrtlecrepe paper
crepe rubbercrepe suzettecrepelikecreperie
crepeycrepidomacrepiscrepitant
crepitatecrepitatedcrepitatingcrepitation
crepitation ralecrepitouscrepituscrepon
creptcrepusclecrepuscularcrepuscular ray
crepuscularitycrepuscularlycrepusculecrepusculine
crepusculouscrepusculumcreraritecrescence
crescendocrescendo biosciencecrescentcrescent city
crescent mooncrescent rollcrescent unmanned s…crescent-cell anaem…
crescent-cell anemiacrescent-shapedcrescentiacrescentia cujete
crescenticcrescentinicrescentiuscrescentwise
crescivecrescocrescographcresol
cresolatecresorcincrespellecrespi, giuseppe
crespinecrespocresscress green
cress plantcressellecressescresset
cressidacresslikecressoncressy
crestcrest cloudcrest syndromecrestatech
crestedcrested cariamacrested coral rootcrested lark
crested mynacrested penguincrested screamercrested swift
crested titcrested wheat grasscrested wheatgrasscrestfallen
crestiecrestingcrestlesscrestless wave
crestmontcrestone telecomcreswell, sir cresw…creswick, thomas
cresylcresyliccreta, oklahomacretacean
cretaceouscretaceous periodcretaceouslycretacious
cretancretan dittanycretecrete dittany
cretiancreticcreticismcretin
cretinisecretinismcretinizecretinoid
cretinouscretismcretonnecretor
cretosecreusacreusecreusot, le
creutzercreutzfeldt-jakob d…creutzfeldt-jakob s…creutzfeldt–jakob…
creuxcreuzercrevallecrevalle jack
crevantcrevassecrèvecœurcrevet
crevicecrevice corrosioncrevicedcrevis
crewcrew chiefcrew cutcrew member
crew neckcrew necklinecrew sockcrew-served weapon
crewcutcrewecrewedcrewel
crewelworkcrewercrewetcrewless
crewmancrewmatecrewmembercrewneck
crewneckedcrexcrex crexcrfs
cri de coeurcri de coeur*cri du chat syndromecri technologies
cri-du-chat syndromecriacribcrib board
crib deathcrib mattresscrib notecrib sheet
crib-bitercrib-bitingcribbagecribbage board
cribbedcribbercribbingcribble
cribbledcribblingcribellumcriber
criblikecribratecribrationcribriform
cribriform platecribrosecribrouscric
cricetidcricetidaecricetinaecricetulus
cricetuscricetus cricetuscrichtoncrichton, james
crichtonitecricifycrickcricket
cricket ballcricket batcricket equipmentcricket field
cricket frogcricket groundcricket matchcricket pitch
cricket whitescricket-bat willowcricketercricketing
cricketlesscricketscricketycricoid
cricoid cartilagecricondenthermcricothyroidcricothyroidotomy
criddleitecriedcrieffcrier
criescriestcrigancrigler-najjar synd…
crigler–najjar sy…crikeycrilecrillon
crimcrimblecrimbocrime
crime against human…crime against naturecrime analysiscrime and punishment
crime fictioncrime lordcrime of passioncrime prevention
crime ratecrime scenecrime statisticscrime syndicate
crime victimscrime wavecrime-riddencrimea
crimea-congo hemorr…crimeancrimean peninsulacrimean tatar
crimean warcrimebustercrimebustingcrimefighter
crimefightingcrimefreecrimefulcrimeless
crimelikecrimereportscrimeriddencrimes
crimes against huma…crimethinc.crimethinkcrimeware
crimewatch uscrimewavecrimidinecriminal
criminal activitycriminal congresscriminal contemptcriminal conversati…
criminal courtcriminal intelligen…criminal intentcriminal investigat…
criminal lawcriminal negligencecriminal offencecriminal possession
criminal procedurecriminal prosecutioncriminal psychologi…criminal psychology
criminal recordcriminal suitcriminalisationcriminalise
criminalismcriminalistcriminalisticscriminality
criminalizationcriminalizecriminallycriminalness
criminaloidcriminalscriminatecriminated
criminatingcriminationcriminativecriminatory
criminicriminogenicallycriminol.criminological
criminologistcriminologycriminouscriminousness
criminycrimosincrimpcrimpage
crimpedcrimpercrimpingcrimple
crimpledcrimplingcrimpnesscrimpy
crimsoncrimson clovercrimson glorycrimson hexagon
crimson informaticscrimsonedcrimsoningcrimsonly
crimsonnesscrinalcrinan canalcrinated
crinatorycrincumcrincum-crancumcrined
crinelcrinetcringecringeling
cringemakingcringercringeworthycringing
cringinglycringingnesscringlecringy
criniculturalcrinierecrinigerouscrinion
crinitalcrinitecrinitorycrinivirus
crinklecrinkle rootcrinkle-rootcrinkled
crinklerootcrinklinesscrinklingcrinkly
crinkycrinoidcrinoidalcrinoidea
crinoideancrinolinecrinolinedcrinose
crinositycrinumcrioboliumcriollo
criollo peoplecriosphinxcrioulocrip
cripescripplecripple creekcrippled
crippled insidecripplenesscripplercrippleware
cripplingcripplinglycripplycrips
criptcriscocrisescrisis
crisis action plann…crisis centercrisis interventioncrisis management
crisis negotiationcrisis-riddencrispcrisp bread
crispatecrispatedcrispationcrispature
crispbreadcrispedcrispencrisper
crisphead lettucecrispi, francescocrispilycrispin
crispin and crispin…crispinesscrispingcrisply
crispnesscrispscrispuscrispy
crispy gamercrispy!criss-crosscriss-cross applesa…
crissacrissalcrisscrosscrisscross heart
crisscross-rowcrisscrossedcrissumcrist
cristacristalcristalinacristallo
cristallologycristatecristinacristo redentor
cristobalcristobal balenciagacristóbal carbinecristobal colon
cristobalitecristoforo colombocritcrit.
critchfieldcriteriacriterialcriterion
criterionalcriterionlesscriterionscriterior
criteriumcrithcrithidiacrithidia fascicula…
crithomancucrithomancycritiascritic
criticalcritical acclaimcritical analysiscritical angle
critical appraisalcritical assetcritical asset listcritical capability
critical carecritical conditioncritical control po…critical diagnostics
critical functioncritical illnesscritical informationcritical infrastruc…
critical inquirycritical intelligen…critical itemcritical item list
critical joint duty…critical literacycritical masscritical media
critical micelle co…critical occupation…critical opalescencecritical path
critical path methodcritical pathwayscritical periodcritical period (ps…
critical pointcritical practicecritical rationalismcritical requirement
critical reviewcritical reynolds n…critical sectioncritical speed
critical supplies a…critical sustainabi…critical technologi…critical theory
critical thinkingcritical tide levelcritical updatecritical vulnerabil…
criticalitycriticality assessm…criticallycritically acclaimed
criticalmetricscriticalnesscriticastercriticisable
criticisecriticisedcriticisercriticising
criticismcriticisms of globa…criticizablecriticization
criticizecriticizercriticizinglycritico
criticproofcriticscritiquecritique^it
crititechcritoncrittercritter sitter
crittercismcritterscriuscrix labs
crixivancrizzelcrizzlecrizzled
crk-associated subs…crlfcrm softwarecrna gora
crngedcrocroûtecro-magnon
cro-quettecroaghcroakcroaked
croakercroakingcroakycroat
croatiacroatiancroatian peasant pa…croatian sheepdog
croato-serbiancroa`tia and slavon…croccrocacin
crocanthemum canade…crocecroceincroceous
crocethiacrocethia albacrocetincroche
crochetcrochet hookcrochet needlecrochet stitch
crochetedcrochetercrochetingcrochetwork
crochucrociarycrocidolitecrocin
crockcrock of goldcrock of shitcrock pot
crock upcrockedcrockercrockers
crockerycrocketcrocketedcrocketing
crockettcrockett, samuel ru…crockingcrockpot
crockycrocodilecrocodile birdcrocodile clip
crocodile rivercrocodile tearcrocodile tearscrocodilelike
crocodiliacrocodiliancrocodilian reptilecrocodility
crocodiluscrocodoccrocodyliacrocodylidae
crocodyliformcrocodylomorphcrocodyluscrocodylus niloticus
crocodylus porosuscrocoisitecrocoitecrocolite
croconatecroconazolecroconiccroconic acid
crocosecrocosmiacrocottacrocs
crocuscrocus sativuscrocus technologycrocuslike
crocutacrocuta crocutacroesuscroft
croftercroftingcroftlandcrohn
crohn diseasecrohn's diseasecrohns diseasecroire
croiscroisadecroisadocroise
croissantcroissantecroissantlikecrois\u00e9
croix de guerrecrokercroker, john wilsoncroker, t. crofton
croll, jamescroly, georgecromacromagnon
cromakalimcromarcromartycrome
crome, johncromlechcromniomancycromoglicate
cromoglicic acidcromoglycatecromolyncromolyn sodium
cromornacromornecromptoncrompton urban dist…
crompton, samuelcromulentcromwellcromwell (oliver)
cromwell, olivercromwell, richardcromwell, thomascromwellian
cronartiumcronartium ribicolacronecronel
cronelikecronenbergiancronetcronian
croniescronkcronocronote
cronstadtcronstedtitecrontabcronus
cronusitecronycronyismcronyistic
croo monkeycroodlecrookcrook and nanny
crookackcrookbackcrookbackedcrookbill
crookedcrooked-stemmed ast…crookedlycrookedness
crookencrookerycrookescrookes radiometer
crookes tubecrookes, williamcrookesitecrooking
crookneckcrookneck squashcrookscroon
croonedcroonercrooningcroony
cropcrop circlecrop failurecrop out
crop residuecrop rotationcrop topcrop up
crop venturescrop-dustingcrop-earcrop-eared
crop-tailedcropboundcropdustercrope
cropfulcroplandcroplandscroplike
croppablecroppedcroppercropping
crops, agriculturalcropsickcropupcroque-madame
croque-monsieurcroquembouchecroquetcroquet ball
croquet equipmentcroquet malletcroquetacroqueted
croquetingcroquetlikecroquettecroquis
crorecrorepaticrosbycroscarmellose
crosiercrosieredcrosletcrosne
crospovidonecrosscross a bridge befo…cross bat
cross bitcross buncross channelcross check
cross circulationcross compilercross connectioncross country
cross cover versioncross crossletcross dressingcross examination
cross examinecross fellcross firecross flory
cross haircross hairscross infectioncross junction
cross matchingcross merchandisingcross multiplycross of calvary
cross of goldcross of lorrainecross offcross one's eyes
cross one's fingerscross ones armscross ones fingerscross ones heart
cross oneselfcross outcross overcross paths
cross patt\u00e9ecross peen hammercross pixel mediacross post
cross productcross protectioncross purposecross purposes
cross questioncross reactionscross referencecross roads
cross seacross sectioncross someones palmcross someones path
cross streetcross swordscross tabcross tabulation
cross talkcross tellcross that bridge w…cross the aisle
cross the floorcross the linecross the rubiconcross thwart
cross vinecross windcross wirecross, mrs.
cross, southerncross, victoriacross-cross-action
cross-armedcross-bandedcross-bearercross-bedding
cross-benchcross-benchercross-birthcross-border
cross-bredcross-breedcross-breedingcross-browser
cross-buncross-capcross-channelcross-check
cross-classificationcross-compatiblecross-connecting bo…cross-console emula…
cross-contaminatecross-contaminationcross-correlationcross-country
cross-country jumpi…cross-country ridingcross-country skiingcross-cousin
cross-crossletcross-culturalcross-cultural comp…cross-cutting
cross-dayscross-divisioncross-dockingcross-dress
cross-dressercross-dressingcross-examinationcross-examine
cross-examinedcross-examinercross-examiningcross-eye
cross-eyedcross-fertilecross-fertilisationcross-fertilise
cross-fertilizationcross-fertilizecross-filecross-fire
cross-fostercross-fosteringcross-garnetcross-grained
cross-indexcross-infectioncross-jack yardcross-lag
cross-leaved heathcross-leggedcross-levelingcross-light
cross-linguisticcross-linguisticallycross-linkcross-linkage
cross-linkedcross-linking reage…cross-loading (pers…cross-magnetizing e…
cross-modalcross-multiplicationcross-multiplycross-over block
cross-over studiescross-partycross-patchcross-pawl
cross-phrasingcross-platformcross-plycross-pollinate
cross-pollinatingcross-pollinationcross-primingcross-purpose
cross-questioncross-questionedcross-questionercross-questioning
cross-ratiocross-reactcross-reactioncross-reactivity
cross-readingcross-refercross-referencecross-resistance
cross-sectioncross-sectionalcross-sectional stu…cross-sell
cross-sellingcross-sententialcross-servicingcross-shaped
cross-spalecross-spallcross-springercross-staff
cross-stitchcross-stitchercross-stonecross-tab
cross-tailcross-targeting (nu…cross-tiecross-tining
cross-tolerancecross-towncross-traincross-training
cross-treescross-validationcross-vaultingcross-week
crossbandcrossbandingcrossbarcrossbarred
crossbeakcrossbeamcrossbeam systemscrossbench
crossbenchercrossbenchescrossbillcrossbite
crossbodycrossbonescrossborderscrossbow
crossbow technologi…crossbowercrossbowmancrossbracing
crossbredcrossbreedcrossbreedercrossbreeding
crossbuckcrosscheckcrosschxcrossclaim
crossclasscrosscorrelationcrosscoupledcrosscoupling
crosscourtcrosscurrentcrosscutcrosscut saw
crosscuttingcrossecrosse, andrewcrossectional
crossedcrossed eyecrossed fingerscrossed loop sensor
crossed outcrossercrossettecrosseyed
crossfadecrossfadercrossfeedcrossfiber
crossfieldcrossfirecrossfirst bankcrossfish
crossflowcrossgendercrossgradecrossgrained
crossguardcrosshaircrosshairscrosshatch
crosshatchedcrosshatchingcrossheadcrossheading
crossingcrossing areacrossing automationcrossing guard
crossing numbercrossing overcrossing over, gene…crossing the line
crossing wirescrossingscrossjackcrosslegged
crossletcrosslicensecrosslightcrosslike
crosslinearcrosslinearlycrosslinguisticcrosslink
crosslinkercrossloadcrossloopcrosslots
crosslycrossmatchcrossmatchedcrossmetathesis
crossnathcrossnationalcrossnesscrossopterygian
crossopterygiicrossovercrossover dribblecrossover health ma…
crossover votecrossover votercrosspatchcrosspiece
crosspipecrossplaycrossplayercrosspoint
crosspostcrosspostercrossraguelcrossrange
crossreactcrossreactioncrossreactivecrossref
crossroadcrossroadscrossroads systemscrossrow
crossruffcrosstabcrosstalkcrosstie
crosstowncrosstreecrosstreescrosstx
crosswalkcrosswaycrosswayscrossways, dorset
crosswindcrosswisecrosswordcrossword (puzzle)
crossword puzzlecrosswordlikecrossworld warrantycrosswort
crostatacrostinicrotalcrotalaria
crotalaria sagitall…crotalaria spectabi…crotalid venomscrotalidae
crotalinecrotalocrotalumcrotalus
crotalus adamanteuscrotalus atroxcrotalus cerastescrotalus horridus a…
crotalus horridus h…crotalus lepiduscrotalus mitchelliicrotalus scutulatus
crotalus tigriscrotalus viridiscrotamitoncrotanaldehyde
crotaphioncrotaphitecrotaphiticcrotaphytus
crotchcrotch fruitcrotch haircrotch rocket
crotch, williamcrotchedcrotchescrotchet
crotchet restcrotchetedcrotchetinesscrotchety
crotchlesscrotoncroton bugcroton eluteria
croton oilcroton tigliumcrotonacrotonaldehyde
crotonamidecrotonatecrotonatescrotonbug
crotonecrotoniccrotonic acidcrotonic acids
crotoninecrotonylenecrotophagacrotoxin
crottalcrottlecrottlescrotyl
crotylationcrotylborationcrouchcrouch down
crouchedcrouchercrouchingcroud
croukecroupcroupadecroupal
croupecroupercroupiercroupier's rake
croupierecroupinesscroupouscroupy
crousecroustadecroutcrouton
crouzon syndromecrowcrow blackbirdcrow corn
crow garliccrow pheasantcrow pointcrow scarer
crow stepcrow's feetcrow's footcrow's nest
crow's-feetcrow's-footcrow's-nestcrow-bait
crow-quillcrow-silkcrow-troddencrowbait
crowbarcrowbar hotelcrowberrycrowberry family
crowdcrowd artcrowd catchcrowd control
crowd intocrowd outcrowd playcrowd science
crowd supplycrowd surfercrowd surfingcrowd technologies
crowd togethercrowd upcrowd-poisoningcrowdbooster
crowdcastcrowdcompasscrowdcomputing syst…crowded
crowdengineeringcrowdercrowderscrowdfeed
crowdflikcrowdflowercrowdfundercrowdfunding
crowdgathercrowdhallcrowdiecrowding
crowdlikecrowdlycrowdmedcrowdmob
crowdopticcrowdpleasercrowdrisecrowds
crowdslingcrowdsourcecrowdsourcedcrowdsourcing
crowdspringcrowdstarcrowdstrikecrowdtap
crowdtiltcrowdtwistcrowdvancecrowdy
crowdzonecrowdzucrowe, eyre evanscrowe, sir james ar…
croweatercrowedcrowflowercrowfoot
crowfoot familycrowfoot grasscrowingcrowkeeper
crowleyancrowlikecrowncrown beard
crown biosciencecrown cactuscrown colonycrown compounds
crown courtcrown daisycrown estatecrown ether
crown etherscrown firecrown flowercrown gall
crown glasscrown graftingcrown greencrown green bowls
crown imperialcrown in towncrown jewelcrown jewels
crown landcrown lengtheningcrown lenscrown mammal
crown moldingcrown monkeycrown of thornscrown office
crown pointcrown princecrown princesscrown roast
crown sawcrown sidecrown vetchcrown vic
crown wardcrown wartcrown wheelcrown-beard
crown-imperialcrown-of-the-fieldcrown-postcrown-rump length
crown-sawcrownbeardcrowne, johncrowned
crowned cranecrowned headcrowned pigeoncrownedst
crownercrownetcrowningcrownless
crownletcrownlikecrownpeakcrownpiece
crownscrownworkcrowscrows feet
crows footcrows nestcrowstepcrowstone
crowthcrowther, samuel ad…crowtoecroydon
croydon faceliftcroylstonecroyncroys
crozecroze ironcroziercroziered
crpcrs reprocessing se…crtcrt screen
crtscrucrubeenscruces
cruces, cubacrucialcrucialitycrucially
cruciancrucian carpcruciatecruciate sulcus
cruciationcruciblecrucible steelcrucible, electric
crucifercruciferaecruciferouscruciferous plant
cruciferous vegetab…crucifiedcrucifiercrucifix
crucifix fishcrucifixescrucifixioncrucifixionlike
crucifixlikecruciformcrucifycrucifying
crucigerouscruciverbalismcruciverbalistcruck
crudcruddinesscruddlecruddy
crudecrude oilcrude sapcrude-oil
crudelycruden, alexandercrudenesscrudités
cruditiescruditycrudlecrudos
crudwarecrudycruelcruel and unusual p…
cruel plantcruella de vilcruellycruelness
cruelscrueltiescrueltycruentaren
cruentatecruentouscruetcruet-stand
cruftcruft togethercruftscruftsmanship
cruftycruikshankcruikshank, georgecruis
cruisecruise controlcruise linecruise liner
cruise missilecruise shipcruisedcruiselike
cruisercruiserweightcruisewearcruisewise
cruisingcruising altitudecruising levelcruisy
cruivecrullcrullercrumb
crumb cakecrumb downcrumbclothcrumbed
crumbercrumbilycrumbinesscrumbing
crumblablecrumblecrumbledcrumbler
crumblesscrumbletcrumblikecrumbliness
crumblingcrumblinglycrumblingscrumbly
crumbscrumbumcrumbycrumcake
crumenalcrumhorncrummablecrummily
crumminesscrummockcrummycrump
crumpetcrumpinesscrumplecrumple zone
crumpledcrumplednesscrumplercrumpling
crumplycrumpycrunchcrunch numbers
crunch timecrunchablecrunchedcruncher
crunchinesscrunchingcrunchinglycrunchy
crunchyrollcrunkcrunklecrunodal
crunodecruorcruorincrup
cruppercruracruralcrurophilia
crurotarsalcruscrusadecrusaded
crusadercrusaderlikecrusaderscrusades
crusades, thecrusadingcrusadocruse
cruse, illinoiscrusetcrushcrush hat
crush oncrush on youcrush outcrush party
crush roomcrush syndromecrushablecrushblvd
crushedcrushed leathercrushed rockcrushed sugar
crusheecrushercrusher gaugecrushing
crushinglycrushpathcrushproofcrusoe, robinson
crustcrustacrustaceacrustacean
crustacean larvaecrustaceologicalcrustaceologistcrustaceology
crustaceouscrustaceousnesscrustalcrustal movement
crustal platecrustalogicalcrustalogistcrustalogy
crustatedcrustationcrustedcrustie
crustiescrustificcrustilycrustiness
crustingcrustlesscrustlikecrustose
crustose thalluscrustquakecrustycrut
crutchcrutchedcrutchescrutchlike
cruthcruttercruxcrux australis
crux biomedicalcrux gammatacrux of the mattercrux simplex
cruxescruyff turncruz recordscruza
cruzadocruzadoscruzancruzeiro
crwthcrycry all the way to …cry blue murder
cry downcry forcry for helpcry havoc
cry in ones beercry like a babycry like a little g…cry me a river
cry offcry ones eyes outcry outcry out against
cry out forcry someone a rivercry the bluescry uncle
cry uncle!cry wolfcry-babycry-baby tree
cryaesthesiacryalcrybabycrybaby tree
cryercryesthesiacryin'crying
crying birdcrying callcrying shamecryo-
cryo-electron micro…cryo-transmissioncryo-transmission e…cryoablation
cryoactivationcryoanaesthesiacryoanesthesiacryobench
cryobiologicalcryobiologistcryobiologycryobiosis
cryobioticcryobuffercryocardioplegiacryocautery
cryochreptcryocondensationcryoconitecryocooled
cryocoolercryocoolingcryocrystallographycryodetector
cryoelectroncryoelectron micros…cryoelectroncscryoelectronic
cryoelectronicscryofixationcryofixedcryofocus
cryofocusingcryogencryogenesiscryogenian
cryogeniccryogenic liquidcryogenicallycryogenics
cryogeninecryogenycryoglobulincryoglobulinemia
cryoglobulinscryohydratecryohydriccryokinesis
cryolathecryolitecryolithionitecryolitic
cryomagneticcryometercryometriccryometry
cryomicrographcryomicroscopiccryomicroscopycryomodule
cryoniccryonicscryopathycryopelagic
cryophiliccryophobiacryophoruscryophysics
cryophytecryoplanktoncryoportcryoprecipitate
cryopreservationcryopreservecryopreservedcryopreserving
cryoprobecryoprotectcryoprotectedcryoprotection
cryoprotective agen…cryopumpcryopyrincryopyrin-associate…
cryoregimecryosamplingcryoscopecryoscopic
cryoscopycryosectioncryosectionedcryosectioning
cryosleepcryosolventcryospherecryospheric
cryostasiscryostatcryostaticcryosurgeon
cryosurgerycryosurgicalcryosurgicallycryotechnology
cryotemperaturecryotherapistcryotherapycryotomographic
cryotomographycryotrapcryotrappingcryotron
cryoturbationcryoultramicrotomycryovialcryovolcanic
cryovolcanismcryovolcanocryoxtract instrume…cryppie
crypsiscryptcryptacanthodescryptacanthodes mac…
cryptalcryptanalysiscryptanalystcryptanalytic
cryptanalyticscryptandcryptarithmcryptate
crypticcryptic colorationcryptic crosswordcryptical
crypticallycrypticitycryptidcryptidine
cryptlikecryptocrypto-crypto-fascism
crypto-fascistcrypto-fascisticcrypto-revisionismcryptobiont
cryptobiosiscryptobioticcryptobranchiatacryptobranchiate
cryptobranchidaecryptobranchuscryptobranchus alle…cryptocarya
cryptocercidaecryptocercuscryptochannelcryptochiral
cryptochiralitycryptochromecryptochromescryptococcal
cryptococcosiscryptococcuscryptococcus gattiicryptococcus neofor…
cryptocorynecryptocracycryptocrystallinecryptodepression
cryptoexoticcryptogamcryptogamecryptogamia
cryptogamiaecryptogamiancryptogamiccryptogamist
cryptogamouscryptogeniccryptogenic organiz…cryptogenic species
cryptogramcryptogrammacryptogramma acrost…cryptogramma crispa
cryptogrammataceaecryptogrammaticcryptogrammaticallycryptograms
cryptographcryptographalcryptographercryptographic
cryptographic infor…cryptographicalcryptographicallycryptographist
cryptographycryptohalitecryptolaliacryptolect
cryptolepiscryptologiccryptologicalcryptologist
cryptologycryptomariacryptomaterialcryptomelane
cryptomeriacryptomeria japonicacryptomnesiacryptomodule
cryptomonadcryptomorphiccryptomorphismcrypton
cryptonephridialcryptonymcryptonymiccryptopart
cryptophanecryptophonecryptophthalmoscryptophyceae
cryptophytacryptophytecryptopinecryptoporticus
cryptoprocessingcryptoprocessorcryptoproctacryptoprocta ferox
cryptorchidcryptorchidismcryptorchidycryptorchism
cryptosporacryptosporidiidaecryptosporidiosiscryptosporidium
cryptosporidium par…cryptosystemcryptotermescryptotermes brevis
cryptotiscryptotis parvacryptotomographycryptoxanthin
cryptozoologicalcryptozoologistcryptozoologycrypturi
crystalcrystal ballcrystal clearcrystal counter
crystal detectorcrystal gazingcrystal healingcrystal is
crystal latticecrystal methcrystal microphonecrystal momentum
crystal oscillatorcrystal pickupcrystal pleatcrystal radio
crystal rectifiercrystal setcrystal structurecrystal tea
crystal twinningcrystal violetcrystal-clearcrystalgenomics
crystalisationcrystalisecrystalisedcrystalize
crystalizedcrystalliferouscrystallincrystalline
crystalline fructosecrystalline humourcrystalline lenscrystallinity
crystallinscrystallisationcrystallisecrystallised
crystallitecrystallizabilitycrystallizablecrystallization
crystallization, el…crystallizecrystallizedcrystallized fruit
crystallized gingercrystallizercrystallizingcrystallo-
crystalloclastcrystallogenesiscrystallogeniccrystallogenical
crystallogenycrystallogeometricalcrystallographercrystallographic
crystallographicalcrystallographicallycrystallographycrystallography, x-…
crystalloidcrystallomancycrystallometrycrystallophone
crystallurgycrystalluriacrystalplexcry_wolf
cr\u00e8checr\u00e8me anglaisecr\u00e8me br\u00fb…cr\u00e8me caramel
cr\u00e8me de cacaocr\u00e8me de cassiscr\u00e8me de la cr…cr\u00e8me de menthe
cr\u00e8me fra\u00e…cr\u00e9maill\u00e8…cr\u00eape de chinecr\u00eape paper
cr\u00eape suzettecr\u00eapy  

The Web's Largest Resource for

Definitions & Translations


A Member Of The STANDS4 Network