Found 3,170 definitions starting with CR:

crcrêpesuzettecrèchecrème
crèmedecacaocrèmedecassiscrèmedelacr&…crèmedementhe
crèmefra&ici…crèvecoeurcr.cr/che
crabcrab applecrab boilcrab burger
crab cactuscrab canoncrab cocktailcrab grass
crab legscrab louiscrab lousecrab mentality
crab nebulacrab rangooncrab spidercrab tree
crab-eatercrab-eating dogcrab-eating foxcrab-eating macaque
crab-eating opossumcrab-eating raccooncrab-eating sealcrab-plover
crab-yawscrabapplecrabapple jellycrabbe, george
crabbedcrabbedlycrabbednesscrabber
crabbilycrabbinesscrabbingcrabbish
crabbitcrabburgercrabbycrabby person
crabeatercrabeater sealcrabercrabfaced
crabgrasscrabletcrablikecrabmeat
crabronidcrabscrabsidlecrabstick
crabwisecrac!crachecracid
cracidaecrackcrack a bookcrack a crib
crack a fatcrack a smilecrack a smile... an…crack addict
crack babycrack cocainecrack downcrack down (on)
crack down oncrack ficcrack housecrack of dawn
crack of doomcrack oncrack ones fingerscrack onto
crack pipecrack rockcrack rootcrack seed
crack shotcrack throughcrack traincrack up
crack whorecrack willowcrack wisecrack-brained
crack-pipecrack-upcrackacrackable
crackbackcrackberrycrackbraincrackbrained
crackdowncrackedcracked tooth syndr…cracked wheat
cracked-wheat breadcrackednesscrackercracker bonbon
cracker boxcracker crumbscracker jackcracker jacks
cracker-barrelcrackerberrycrackerboxcrackerjack
crackerlesscrackerlikecrackerscrackhead
crackhousecrackingcracking upcrackle
crackle chinacrackle – the bes…crackleberrycrackled
cracklescracklewarecracklikecrackling
cracklinglycracklingscracklinscrackly
cracknelcrackowcrackpipecrackpot
crackpotterycrackproofcrackscracksman
cracksmencracktivismcracktrocrackup
crackwhorecrackycracky wagoncracovian
cracoviennecracowcracowescracticidae
cracticinaecracticuscradd signaling ada…cradgedness
cradlecradle capcradle catholiccradle mountain
cradle of civilizat…cradle robbercradle snatchercradle technologies
cradle-to-cradle de…cradle-to-gravecradleboardcradled
cradlelikecradlesongcradlingcraft
craft centrecraft faircraft unioncrafted
craftednesscraftercraftilycraftiness
craftlesscraftlikecrafts centrecraftsman
craftsmanlikecraftsmanlycraftsmanshipcraftsmaster
craftsmencraftspersoncraftspersonshipcraftswoman
craftswomanshipcraftsycraftworkcraftworker
craftycragcragfastcragged
craggednesscraggercraggilycragginess
craggycragscragsmancragsmen
craiccraiecraigcraig flounder
craig serani marshcraig ventnercraig, johncraig, sir thomas
craigenputtockcraigiecraigslistcraigslist inc.
craigslistercraigslistingcraikcraik, george little
craik, mrs.crailcraincraiova
craisincrakecrakeberrycraker
crakowcramcram downcram full
cram schoolcram sessioncram worldwidecram-full
crambecrambe maritimacrambe plantcrambe sponge
crambocrambucramdowncramer
cramer, johann bapt…cramlingtoncrammedcrammer
crammingcramoisiecramoisycramp
cramp ironcramp someones stylecrampbarkcramped
crampednesscrampetcrampfishcrampiness
crampingcrampitcramponcramponee
cramponscrampooncrampoonscramps
crampycramstercrancranach
cranach, lucascranachancranagecranapple
cranberriescranberrycranberry bushcranberry culture
cranberry heathcranberry juicecranberry morphemecranberry sauce
cranberry treecranberryingcranberrylikecrance
cranchcrandallitecranecrane fly
crane shotcrane's billcrane's-billcrane, ichabod
crane, waltercrane-drivercranedcranefly
cranelikecranescranesbillcrang
crangoncrangonidaecranhamcrania
cranialcranial cavitycranial fontanellescranial fossa, ante…
cranial fossa, midd…cranial fossa, post…cranial indexcranial irradiation
cranial nervecranial nerve disea…cranial nerve injur…cranial nerve neopl…
cranial nervescranial orbitcranial sinusescranial sutures
craniallycraniatacraniatecranidium
craniectomycraningcraniocaudalcraniocerebral trau…
cranioclasmcranioclastcraniodentalcraniofacial
craniofacial abnorm…craniofacial abnorm…craniofacial dysost…craniofacially
craniognomycraniologicalcraniologicallycraniologist
craniologycraniomandibularcraniomandibular di…craniometer
craniometriccraniometric pointcraniometricalcraniometry
craniopaguscraniopharyngiomacraniosacralcranioscopist
cranioscopycraniosophiccraniosynostosescraniosynostosis
craniotacraniotomycranite systemscranium
craniumscrankcrank anglecrank angle degree
crank callcrank handlecrank lettercrank out
crank sciencecrank upcrankbirdcrankcase
crankedcrankilycrankinesscrankle
cranknesscrankpincrankscrankset
crankshaftcrankycranmercranmer, thomas
cranniedcranniescrannockcrannog
crannogecrannycrannyingcranston
crantcrantaracrantscrap
crap artistcrap gamecrap on a stickcrap ones pants
crap outcrap shootingcrap upcrap-shooter
crapaudcrapaud, jeancrapaudinecrape
crape ferncrape jasminecrape myrtlecraped
crapefishcrapehangercrapelikecrapette
crapfacecrapfestcrapfloodcrapgame
craphatcrapheadcrapholecraphouse
crapingcraploadcrapmobilecrapnel
crapolacrappercrappiecrappily
crappinesscrappitycrapplecrapplet
crappocrappycrapscrapshoot
crapshootercrapstormcraptacularcraptastic
craptasticalcraptexcrapulacrapule
crapulencecrapulentcrapulentallcrapulous
crapulouslycrapulousnesscrapwarecrapy
craquelurecrarecrascrase
crashcrash and burncrash barriercrash box
crash cartcrash coursecrash cymbalcrash diet
crash divecrash gearboxcrash helmetcrash hot
crash landcrash landingcrash locator beaconcrash out
crash padcrash position indi…crash programcrash programme
crash rescue and fi…crash spacecrash testcrash test dummy
crash trolleycrash-divecrash-helmetcrash-land
crashablecrashawcrashaw, richardcrashdump
crashedcrashercrashingcrashingly
crashlesscrashlikecrashlyticscrashpad
crashproofcrashworthinesscrashworthycrashy
crasiscraspediacraspedotacraspedote
crasscrassamentcrassamentumcrassiment
crassitudecrasslycrassnesscrassostrea
crassulacrassula ovatacrassulaceaecrassulacean
crassuscrassus, lucius lic…crassus, marcus lic…crastination
cratcrataeguscrataegus aestivaliscrataegus apiifolia
crataegus biltmorea…crataegus calpodend…crataegus coccineacrataegus coccinea …
crataegus crus-gallicrataegus laevigatacrataegus marshalliicrataegus mollis
crataegus monogynacrataegus oxyacanthacrataegus oxycanthacrataegus pedicella…
crataegus tomentosacratchcratecrated
cratefulcrateloadcratercrater face
crater lakecrater lake nationa…crater moundcratered
crateriformcratering chargecraterlesscraterlet
craterlikecraterostigmacraterouscraters of the moon
cratescratevacratingcratinus
cratippuscratippus of athenscratolagniacratology
cratoncratoniccraturcratureless
cratyluscraugastor augusticraunchcraunched
craunchingcravatcravattedcrave
cravedcravencravenedcravenette
craveningcravenlycravennesscraver
cravingcravingnesscrawcrawdad
crawdaddycrawdaddy!crawfishcrawfish out
crawfordcrawford and balcar…crawford, marioncrawford, thomas
crawforditecrawkcrawlcrawl in
crawl spacecrawl withcrawlablecrawled
crawlercrawlerwaycrawleycrawling
crawling back to youcrawling horrorcrawlspacecrawly
craxcraycrayecrayer
crayer, caspar decrayettecrayfishcrayfisher
crayfishermancrayfisherycrayolacrayon
crayonedcrayoningcrayonlikecraythur
crayturcrazecraze-millcrazed
crazedlycrazednesscrazilycraziness
crazingcrazing-millcrazycrazy bitch
crazy bonecrazy eightscrazy eyescrazy glue
crazy golfcrazy horsecrazy housecrazy like a fox
crazy pavingcrazy quiltcrazy weedcrazy-ass
crazyweedcrccrc handbookcré
creablecreacionismocreaghtcreak
creakedcreakilycreakinesscreaking
creakinglycreakle, mr.creakycream
cream cakecream cheesecream corncream cracker
cream crackeredcream in ones jeanscream laidcream of tartar
cream of the cropcream of wheatcream offcream pie
cream pitchercream puffcream saucecream soda
cream teacream upcream violetcream-colored
cream-colored cours…cream-facedcream-fruitcream-of-tartar tree
cream-slicecream-whitecreamcakecreamcups
creamedcreamed corncreamercreameries
creamerycreamilycreaminesscreaming
creamlesscreamlikecreampiecreamsicle
creamwarecreamycreancecreant
creasecrease-resistantcreasedcreaseless
creaseproofcreasercreaseyitecreashak
creasingcreasotecreasycreasy, sir edward
creatcreatablecreatecreate (dc)
create by mental actcreate from raw mat…create from raw stu…create mentally
create verballycreate, read, updat…createdcreated by
createscreaticcreatincreatine
creatine kinasecreatine kinase, bb…creatine kinase, mb…creatine kinase, mi…
creatine kinase, mm…creatine phosphatecreatine phosphoric…creating
creating by mental …creating by removalcreating from raw m…creating one flesh
creatinincreatininasecreatininecreation
creation sciencecreationalcreationarilycreationary
creationismcreationistcreationisticcreativasc medical
creativecreative accountingcreative activitycreative allies
creative artists ag…creative brain stud…creative circle adv…creative citizen
creative commonscreative commons li…creative destructioncreative differences
creative energycreative personcreative skillsetcreative thinker
creative thinkingcreative workcreative writingcreativelive
creativelycreativenesscreativitycreator
creatorlesscreatorlikecreatorscreatorship
creatresscreatrixcreaturalcreature
creature comfortcreature comfortscreature featurecreaturedom
creaturelesscreaturelikecreaturelinesscreaturely
creaturescreatures of habitcreatureshipcreaturize
creazecrebcreb-binding proteincrébillon
crebricostatecrebrisulcatecrebritudecrebrous
crechecrécycredcredal
credant technologiescredecredencecredence table
credendacredendumcredentcredential
credentialedcredentialingcredentialismcredentialization
credentialscredenzacrederitycredibility
credibility gapcrediblecrediblenesscredibly
creditcredit accountcrédit agricole co…credit analyst
credit applicationcredit bureaucredit cardcredit card fraud
credit card tartcredit crunchcredit default opti…credit default swap
credit entrycredit eventcrédit fonciercredit history
credit hourcredit limitcredit linecredit mobilier
credit notecredit ordercredit ratingcredit reference
credit reportcredit riskcredit scorecredit score in the…
credit sesamecredit sidecredit systemcredit transfer
credit unioncredit-deposit ratiocreditabilitycreditable
creditablenesscreditablycreditedcrediting
creditlesscréditocreditorcreditor's rights
creditors rightscreditresscreditrixcredits
creditworthinesscreditworthycredneritecredo
credobaptistcredophilecredoraxcredulitiveness
credulitycredulouscredulouslycredulousness
creecreech, kentuckycreech, williamcreed
creedalcreeditecreedlesscreedmore
creedscreekcreek bedcreek confederacy
creekfishcreekfrontcreekologycreeks
creeksidecreekwatercreekycreel
creelercreemcreepcreep feed
creep increep intocreep jointcreep someone out
creep upcreep up oncreepagecreeper
creepethcreepholecreepiecreepify
creepilycreepinesscreepingcreeping barrage
creeping bellflowercreeping bentcreeping bentgrasscreeping bugle
creeping buttercupcreeping charliecreeping crowfootcreeping elegance
creeping featurismcreeping featuritiscreeping ferncreeping jenny
creeping junipercreeping lilycreeping minecreeping oxalis
creeping snowberrycreeping soft grasscreeping spike rushcreeping st john's …
creeping thistlecreeping thymecreeping willowcreeping windmill g…
creeping wintergreencreeping wood sorrelcreeping zinniacreepingly
creeplecreepmetercreepscreepy
creepy-crawliescreepy-crawlycreepy-peepycrees
creesecreftingcreighton, mandellcrema
cremaillerecremainscremastercremasteric
crematecremationcremation chambercremationist
crematorcrematorialcrematoriescrematorium
crematoriumscrematorycremecreme anglais
creme bruleecreme caramelcreme de cacaocreme de fraise
creme de menthecrème fraîchecrémieuxcremo, west virginia
cremocarpcremonacremorcremorne
cremosincremscremulatorcrenarchaeal
crenarchaeoncrenarchaeotacrenarchaeotalcrenarchaeote
crenatecrenate leafcrenatedcrenation
crenaturecrenelcrenelatecrenelated
crenelated moldingcrenelatingcrenelationcrenellate
crenellatedcrenellated mouldingcrenellationcrenelle
crenelledcrenglecrenic acidcrenkle
crenotherapycrenshawcrenulatecrenulated
crenulationcreocreodontcreole
creole statecreole-fishcreoleancreolian
creolincreolizationcreolizecreon
creopointcreosolcreosotecreosote bush
creosotedcreosotelikecreosotingcrep
crepancecrepanecrepecrepe de chine
crepe ferncrepe flowercrepe gardeniacrepe jasmine
crepe marocaincrepe myrtlecrepe papercrepe rubber
crepe suzettecrepelikecreperiecrepey
crepidomacrepiscrepitantcrepitate
crepitatedcrepitatingcrepitationcrepitation rale
crepitouscrepituscreponcrept
crepusclecrepuscularcrepuscular raycrepuscularity
crepuscularlycrepusculecrepusculinecrepusculous
crepusculumcrépy, aisnecreraritecres
crescencecrescendocrescendo biosciencecrescent
crescent citycrescent mooncrescent rollcrescent unmanned s…
crescent-cell anaem…crescent-cell anemiacrescent-shapedcrescentia
crescentia cujetecrescenticcrescentinicrescentius
crescentwisecrescivecrescocrescograph
cresolcresolatecresorcincrespelle
crespi, giuseppecrespinecrespocress
cress greencress plantcressellecresses
cressetcressidacresslikecresson
cressycrestcrest cloudcrest syndrome
crestatechcrestedcrested cariamacrested coral root
crested larkcrested mynacrested penguincrested screamer
crested swiftcrested titcrested wheat grasscrested wheatgrass
crestfallencrestiecrestingcrestless
crestless wavecrestmontcrestone telecomcreswell
creswell, sir cresw…creswick, thomascresylcresylic
creta, oklahomacretaceancretaceouscretaceous period
cretaceouslycretaciouscretancretan dittany
cretecrete dittanycretiancretic
creticismcretincretinisecretinism
cretinizecretinoidcretinouscretism
cretonnecretorcretosecreusa
creusecreusot, lecreutzercreutzfeldt-jakob d…
creutzfeldt-jakob s…creutzfeldt–jakob…creuxcreuzer
crevallecrevalle jackcrevantcrevasse
crèvecœurcrevetcrevicecrevice corrosion
crevicedcreviscrewcrew chief
crew cutcrew membercrew neckcrew neckline
crew sockcrew-served weaponcrewcutcrewe
crewedcrewelcrewelworkcrewer
crewetcrewlesscrewmancrewmate
crewmembercrewneckcrewneckedcrex
crex crexcrfscrgcri de coeur
cri de coeur*cri du chat syndromecri technologiescri-du-chat syndrome
criacribcrib boardcrib death
crib mattresscrib notecrib sheetcrib-biter
crib-bitingcribbagecribbage boardcribbed
cribbercribbingcribblecribbled
cribblingcribellumcribercriblike
cribratecribrationcribriformcribriform plate
cribrosecribrouscriccricetid
cricetidaecricetinaecricetuluscricetus
cricetus cricetuscrichtoncrichton, jamescrichtonite
cricifycrickcricketcricket ball
cricket batcricket equipmentcricket fieldcricket frog
cricket groundcricket matchcricket pitchcricket whites
cricket-bat willowcricketercricketingcricketless
cricketscricketycricoidcricoid cartilage
cricondenthermcricothyroidcricothyroidotomycriddleite
criedcrieffcriercries
criestcrigancrigler-najjar synd…crigler–najjar sy…
crikeycrilecrilloncrim
crimblecrimbocrimecrime against human…
crime against naturecrime analysiscrime and punishmentcrime fiction
crime lordcrime of passioncrime preventioncrime rate
crime scenecrime statisticscrime syndicatecrime victims
crime wavecrime-riddencrimeacrimea-congo hemorr…
crimeancrimean peninsulacrimean tatarcrimean war
crimebustercrimebustingcrimefightercrimefighting
crimefreecrimefulcrimelesscrimelike
crimereportscrimeriddencrimescrimes against huma…
crimethinc.crimethinkcrimewarecrimewatch us
crimewavecrimidinecriminalcriminal activity
criminal citationcriminal congresscriminal contemptcriminal conversati…
criminal courtcriminal intelligen…criminal intentcriminal investigat…
criminal justicecriminal lawcriminal negligencecriminal offence
criminal possessioncriminal procedurecriminal prosecutioncriminal psychologi…
criminal psychologycriminal recordcriminal suitcriminalisation
criminalisecriminalismcriminalistcriminalistics
criminalitycriminalizationcriminalizecriminally
criminalnesscriminaloidcriminalscriminate
criminatedcriminatingcriminationcriminative
criminatorycriminicriminogenicallycriminol.
criminologicalcriminologistcriminologycriminous
criminousnesscriminycrimosincrimp
crimpagecrimpedcrimpercrimping
crimplecrimpledcrimplingcrimpness
crimpycrimsoncrimson clovercrimson glory
crimson hexagoncrimson informaticscrimsonedcrimsoning
crimsonlycrimsonnesscrinalcrinan canal
crinatedcrinatorycrincumcrincum-crancum
crinedcrinelcrinetcringe
cringelingcringemakingcringercringeworthy
cringingcringinglycringingnesscringle
cringycriniculturalcrinierecrinigerous
crinioncrinitalcrinitecrinitory
criniviruscrinklecrinkle rootcrinkle-root
crinkledcrinklerootcrinklinesscrinkling
crinklycrinkycrinoidcrinoidal
crinoideacrinoideancrinolinecrinolined
crinosecrinositycrinumcriobolium
criollocriollo peoplecriosphinxcrioulo
cripcripescripplecripple creek
crippledcrippled insidecripplenesscrippler
cripplewarecripplingcripplinglycripply
cripscriptcriscocrises
crisiscrisis action plann…crisis centercrisis intervention
crisis managementcrisis negotiationcrisis-riddencrisp
crisp breadcrispatecrispatedcrispation
crispaturecrispbreadcrispedcrispen
crispercrisphead lettucecrispi, francescocrispily
crispincrispin and crispin…crispinesscrisping
crisplycrispnesscrispscrispus
crispus attucks: a …crispycrispy gamercrispy!
criss crosscriss-crosscriss-cross applesa…crissa
crissalcrisscrosscrisscross heartcrisscross-row
crisscrossedcrissumcristcrista
cristalcristalinacristallocristallology
cristatecristiano ronaldocristinacristo redentor
cristobalcristobal balenciagacristóbal carbinecristobal colon
cristobalitecristoforo colombocritcrit.
critchfieldcriteriacriterialcriterion
criterionalcriterionlesscriterionscriterior
criteriumcrithcrithidiacrithidia fascicula…
crithomancucrithomancycritiascritic
criticalcritical acclaimcritical analysiscritical angle
critical appraisalcritical assetcritical asset listcritical capability
critical carecritical conditioncritical control po…critical diagnostics
critical discourse …critical enginecritical functioncritical illness
critical informationcritical infrastruc…critical infrastruc…critical inquiry
critical intelligen…critical itemcritical item listcritical joint duty…
critical literacycritical masscritical mediacritical micelle co…
critical occupation…critical opalescencecritical pathcritical path method
critical pathwayscritical periodcritical period (ps…critical point
critical practicecritical rationalismcritical requirementcritical review
critical reynolds n…critical sectioncritical speedcritical supplies a…
critical sustainabi…critical technologi…critical theorycritical thinking
critical tide levelcritical updatecritical valuecritical vulnerabil…
criticalitycriticality assessm…criticallycritically acclaimed
criticalmetricscriticalnesscriticastercriticisable
criticisecriticisedcriticisercriticising
criticismcriticisms of globa…criticizablecriticization
criticizecriticizercriticizinglycritico
criticproofcriticscritiquecritique^it
crititechcritoncrittercritter sitter
crittercismcritterscriuscrix labs
crixivancrizzelcrizzlecrizzled
crk-associated subs…crlfcrm softwarecrna gora
crngedcrocroûtecro-magnon
cro-quettecroaghcroakcroaked
croakercroakingcroakycroat
croatiacroatiancroatian peasant pa…croatian sheepdog
croato-serbiancroatscroa`tia and slavon…croc
crocacincrocanthemum canade…crocecrocein
croceouscrocethiacrocethia albacrocetin
crochecrochetcrochet hookcrochet needle
crochet stitchcrochetedcrochetercrocheting
crochetworkcrochucrociarycrocidolite
crocincrockcrock of goldcrock of shit
crock potcrock upcrockedcrocker
crockerscrockerycrocketcrocketed
crocketingcrockettcrockett, samuel ru…crocking
crockpotcrockycrocodilecrocodile bird
crocodile clipcrocodile rivercrocodile tearcrocodile tears
crocodilelikecrocodilescrocodiliacrocodilian
crocodilian reptilecrocodilitycrocodiluscrocodoc
crocodyliacrocodylidaecrocodyliformcrocodylomorph
crocodyluscrocodylus niloticuscrocodylus porosuscrocoisite
crocoitecrocolitecroconatecroconazole
croconiccroconic acidcrocosecrocosmia
crocottacrocscrocuscrocus sativus
crocus technologycrocuslikecrocutacrocuta crocuta
croesuscroftcroftercrofting
croftlandcrohncrohn diseasecrohn's disease
crohns diseasecroirecroiscroisade
croisadocroisecroissantcroissante
croissantlikecrois\u00e9croix de guerrecroker
croker, john wilsoncroker, t. croftoncroll, jamescroly, george
cromcromacromagnoncromakalim
cromarcromartycromecrome, john
cromlechcromniomancycromoglicatecromoglicic acid
cromoglycatecromolyncromolyn sodiumcromorna
cromornecromptoncrompton urban dist…crompton, samuel
cromulentcromwellcromwell (oliver)cromwell, oliver
cromwell, richardcromwell, thomascromwelliancronartium
cronartium ribicolacronecronelcronelike
cronenbergiancronetcroniancronies
cronkcronocronotecronstadt
cronstedtitecrontabcronuscronusite
cronycronyismcronyisticcroo monkey
croodlecrookcrook and nannycrookack
crookbackcrookbackedcrookbillcrooked
crooked-stemmed ast…crookedlycrookednesscrooken
crookerycrookescrookes radiometercrookes tube
crookes, williamcrookesitecrookingcrookneck
crookneck squashcrookscrooncrooned
croonercrooningcroonycrop
crop circlecrop failurecrop outcrop protection
crop residuecrop rotationcrop topcrop up
crop venturescrop-dustingcrop-earcrop-eared
crop-tailedcropboundcropdustercrope
cropfulcroplandcroplandscroplike
croppablecroppedcroppercropping
crops, agriculturalcropsickcropupcroque-madame
croque-monsieurcroquembouchecroquetcroquet ball
croquet equipmentcroquet malletcroquetacroqueted
croquetingcroquetlikecroquettecroquis
crorecrorepaticrosbycroscarmellose
crosiercrosieredcrosletcrosne
crospovidonecrosscross a bridge befo…cross bat
cross bitcross buncross channelcross check
cross circulationcross compilercross connectioncross country
cross cover versioncross creekcross crossletcross dressing
cross examinationcross examinecross fellcross fire
cross florycross haircross hairscross infection
cross junctioncross matchingcross merchandisingcross multiply
cross of calvarycross of goldcross of gold speechcross of lorraine
cross offcross one's eyescross one's fingerscross ones arms
cross ones fingerscross ones heartcross oneselfcross out
cross overcross pathscross patt\u00e9ecross peen hammer
cross pixel mediacross postcross productcross protection
cross purposecross purposescross questioncross reactions
cross referencecross roadscross seacross section
cross someones palmcross someones pathcross streetcross swords
cross tabcross tabulationcross talkcross tell
cross that bridge w…cross the aislecross the floorcross the line
cross the rubiconcross thwartcross vinecross wind
cross wirecross, mrs.cross, southerncross, victoria
cross-cross-actioncross-armedcross-banded
cross-bearercross-beddingcross-benchcross-bencher
cross-birthcross-bordercross-bredcross-breed
cross-breedingcross-browsercross-buncross-cap
cross-channelcross-checkcross-classificationcross-compatible
cross-connecting bo…cross-console emula…cross-contaminatecross-contamination
cross-correlationcross-countrycross-country jumpi…cross-country riding
cross-country skiingcross-cousincross-crossletcross-cultural
cross-cultural comp…cross-cuttingcross-dayscross-division
cross-dockingcross-dresscross-dressercross-dressing
cross-examinationcross-examinecross-examinedcross-examiner
cross-examiningcross-eyecross-eyedcross-fertile
cross-fertilisationcross-fertilisecross-fertilizationcross-fertilize
cross-filecross-firecross-fostercross-fostering
cross-garnetcross-grainedcross-indexcross-infection
cross-jack yardcross-lagcross-leaved heathcross-legged
cross-levelingcross-lightcross-linguisticcross-linguistically
cross-linkcross-linkagecross-linkedcross-linking reage…
cross-loading (pers…cross-magnetizing e…cross-modalcross-multiplication
cross-multiplycross-over blockcross-over studiescross-party
cross-patchcross-pawlcross-phrasingcross-platform
cross-plycross-pollinatecross-pollinatingcross-pollination
cross-primingcross-purposecross-questioncross-questioned
cross-questionercross-questioningcross-ratiocross-react
cross-reactioncross-reactivitycross-readingcross-refer
cross-referencecross-resistancecross-sectioncross-sectional
cross-sectional stu…cross-sellcross-sellingcross-sentential
cross-servicingcross-shapedcross-spalecross-spall
cross-springercross-staffcross-stitchcross-stitcher
cross-stonecross-tabcross-tailcross-targeting (nu…
cross-tiecross-tiningcross-tolerancecross-town
cross-traincross-trainingcross-treescross-validation
cross-vaultingcross-weekcrossbandcrossbanding
crossbarcrossbarredcrossbeakcrossbeam
crossbeam systemscrossbenchcrossbenchercrossbenches
crossbillcrossbitecrossbodycrossbones
crossborderscrossbowcrossbow technologi…crossbower
crossbowmancrossbracingcrossbredcrossbreed
crossbreedercrossbreedingcrossbuckcrosscheck
crosschxcrossclaimcrossclasscrosscorrelation
crosscoupledcrosscouplingcrosscourtcrosscurrent
crosscutcrosscut sawcrosscuttingcrosse
crosse, andrewcrossectionalcrossedcrossed eye
crossed fingerscrossed loop sensorcrossed outcrosser
crossettecrosseyedcrossfadecrossfader
crossfeedcrossfibercrossfieldcrossfire
crossfirst bankcrossfishcrossflowcrossgender
crossgradecrossgrainedcrossguardcrosshair
crosshairscrosshatchcrosshatchedcrosshatching
crossheadcrossheadingcrossingcrossing area
crossing automationcrossing guardcrossing numbercrossing over
crossing over, gene…crossing the linecrossing wirescrossings
crossjackcrossleggedcrossletcrosslicense
crosslightcrosslikecrosslinearcrosslinearly
crosslinguisticcrosslinkcrosslinkercrossload
crossloopcrosslotscrosslycrossmatch
crossmatchedcrossmembercrossmetathesiscrossnath
crossnationalcrossnesscrossopterygiancrossopterygii
crossovercrossover dribblecrossover health ma…crossover vote
crossover votercrossoverscrosspatchcrosspiece
crosspipecrossplaycrossplayercrosspoint
crosspostcrosspostercrossraguelcrossrange
crossreactcrossreactioncrossreactivecrossref
crossroadcrossroadscrossroads systemscrossrow
crossruffcrosstabcrosstalkcrosstie
crosstowncrosstreecrosstreescrosstx
crosswalkcrosswaycrosswayscrossways, dorset
crosswindcrosswisecrosswordcrossword (puzzle)
crossword puzzlecrosswordlikecrossworld warrantycrosswort
crostatacrostinicrotalcrotalaria
crotalaria sagitall…crotalaria spectabi…crotalid venomscrotalidae
crotalinecrotalocrotalumcrotalus
crotalus adamanteuscrotalus atroxcrotalus cerastescrotalus horridus a…
crotalus horridus h…crotalus lepiduscrotalus mitchelliicrotalus scutulatus
crotalus tigriscrotalus viridiscrotamitoncrotanaldehyde
crotaphioncrotaphitecrotaphiticcrotaphytus
crotchcrotch fruitcrotch haircrotch rocket
crotch, williamcrotchedcrotchescrotchet
crotchet restcrotchetedcrotchetinesscrotchety
crotchlesscrotenaycrotoncroton bug
croton eluteriacroton oilcroton tigliumcrotona
crotonaldehydecrotonamidecrotonatecrotonates
crotonbugcrotonecrotoniccrotonic acid
crotonic acidscrotoninecrotonylenecrotophaga
crotoxincrottalcrottlecrottles
crotylcrotylationcrotylborationcrouch
crouch downcrouchedcrouchercrouching
croudcroukecroupcroupade
croupalcroupecroupercroupier
croupier's rakecroupierecroupinesscroupous
croupycrousecrouseillescroustade
croutcroutoncrouzon syndromecrow
crow blackbirdcrow corncrow garliccrow pheasant
crow pointcrow scarercrow stepcrow's feet
crow's footcrow's nestcrow's-feetcrow's-foot
crow's-nestcrow-baitcrow-quillcrow-silk
crow-troddencrowbaitcrowbarcrowbar hotel
crowberrycrowberry familycrowdcrowd art
crowd catchcrowd controlcrowd intocrowd out
crowd playcrowd sciencecrowd supplycrowd surfer
crowd surfingcrowd technologiescrowd togethercrowd up
crowd-poisoningcrowdboostercrowdcastcrowdcompass
crowdcomputing syst…crowdedcrowdengineeringcrowder
crowderscrowdfeedcrowdflikcrowdflower
crowdfundercrowdfundingcrowdgathercrowdhall
crowdiecrowdingcrowdlikecrowdly
crowdmedcrowdmobcrowdopticcrowdpleaser
crowdrisecrowdscrowdslingcrowdsource
crowdsourcedcrowdsourcingcrowdspringcrowdstar
crowdstrikecrowdtapcrowdtiltcrowdtwist
crowdvancecrowdycrowdzonecrowdzu
crowe, eyre evanscrowe, sir james ar…croweatercrowed
crowflowercrowfootcrowfoot familycrowfoot grass
crowingcrowkeepercrowleycrowleyan
crowlikecrowncrown attorneycrown beard
crown biosciencecrown cactuscrown colonycrown compounds
crown courtcrown daisycrown estatecrown ether
crown etherscrown firecrown flowercrown gall
crown glasscrown graftingcrown greencrown green bowls
crown imperialcrown in towncrown jewelcrown jewels
crown landcrown lengtheningcrown lenscrown mammal
crown moldingcrown monkeycrown of thornscrown office
crown pointcrown princecrown princesscrown roast
crown sawcrown sidecrown vetchcrown vic
crown wardcrown wartcrown wheelcrown-beard
crown-imperialcrown-of-the-fieldcrown-postcrown-rump length
crown-sawcrownbeardcrowne, johncrowned
crowned cranecrowned headcrowned pigeoncrownedst
crownercrownetcrowningcrownless
crownletcrownlikecrownpeakcrownpiece
crownscrownworkcrowscrows feet
crows footcrows nestcrowstepcrowstone
crowthcrowther, samuel ad…crowtoecroy
croydoncroydon faceliftcroylstonecroyn
croyscrozecroze ironcrozier
crozieredcrpcrs reprocessing se…crt
crt screencrtscrucrubeens
crucescruces, cubacrucialcruciality
cruciallycruciancrucian carpcruciate
cruciate sulcuscruciationcruciblecrucible steel
crucible, electriccrucifercruciferaecruciferous
cruciferous plantcruciferous vegetab…crucifiedcrucifier
crucifixcrucifix fishcrucifixescrucifixion
crucifixionlikecrucifixlikecruciformcrucify
crucifyingcrucigerouscruciverbalismcruciverbalist
cruckcrudcruddinesscruddle
cruddycrudecrude oilcrude sap
crude-oilcrudelycruden, alexandercrudeness
cruditéscruditiescruditycrudle
crudoscrudwarecrudycruel
cruel and unusual p…cruel plantcruella de vilcruelly
cruelnesscruelscrueltiescruelty
cruentarencruentatecruentouscruet
cruet-standcruftcruft togethercrufts
cruftsmanshipcruftycruikshankcruikshank, george
cruiscruisecruise controlcruise line
cruise linercruise missilecruise shipcruised
cruiselikecruisercruiserweightcruisewear
cruisewisecruisingcruising altitudecruising level
cruisycruivecrullcruller
crumcrumbcrumb cakecrumb down
crumbclothcrumbedcrumbercrumbily
crumbinesscrumbingcrumblablecrumble
crumbledcrumblercrumblesscrumblet
crumblikecrumblinesscrumblingcrumblingly
crumblingscrumblycrumbscrumbum
crumbycrumcakecrumenalcrumhorn
crummablecrummilycrumminesscrummock
crummycrumpcrumpetcrumpiness
crumplecrumple zonecrumpledcrumpledness
crumplercrumplingcrumplycrumpy
crunchcrunch numberscrunch timecrunchable
crunchedcrunchercrunchinesscrunching
crunchinglycrunchycrunchyrollcrunk
crunklecrunodalcrunodecruor
cruorincrupcruppercrura
cruralcrurophiliacrurotarsalcrus
crusadecrusadedcrusadercrusaderlike
crusaderscrusadescrusades, thecrusading
crusadocrusecruse, illinoiscruset
crushcrush hatcrush oncrush on you
crush outcrush partycrush roomcrush syndrome
crushablecrushblvdcrushedcrushed leather
crushed rockcrushed sugarcrusheecrusher
crusher gaugecrushingcrushinglycrushpath
crushproofcrusoe, robinsoncrustcrusta
crustaceacrustaceancrustacean larvaecrustaceological
crustaceologistcrustaceologycrustaceouscrustaceousness
crustalcrustal movementcrustal platecrustalogical
crustalogistcrustalogycrustatedcrustation
crustedcrustiecrustiescrustific
crustilycrustinesscrustingcrustless
crustlikecrustosecrustose thalluscrustquake
crustycrutcrutchcrutched
crutchescrutchlikecruthcrutter
cruxcrux australiscrux biomedicalcrux gammata
crux of the mattercrux simplexcruxescruyff turn
cruz recordscruzacruzadocruzados
cruzancruzeirocruzeiro da fortale…cruzeiro do oeste
crwthcrycry all the way to …cry blue murder
cry downcry forcry for helpcry havoc
cry in ones beercry like a babycry like a little g…cry me a river
cry offcry ones eyes outcry outcry out against
cry out forcry someone a rivercry the bluescry uncle
cry uncle!cry wolfcry-babycry-baby tree
cryaesthesiacryalcrybabycrybaby tree
cryercryesthesiacryin'crying
crying birdcrying callcrying shamecryo-
cryo-electron micro…cryo-transmissioncryo-transmission e…cryoablation
cryoactivationcryoanaesthesiacryoanesthesiacryobench
cryobiologicalcryobiologistcryobiologycryobiosis
cryobioticcryobuffercryocardioplegiacryocautery
cryochreptcryocondensationcryoconitecryocooled
cryocoolercryocoolingcryocrystallographycryodetector
cryoelectroncryoelectron micros…cryoelectroncscryoelectronic
cryoelectronicscryofixationcryofixedcryofocus
cryofocusingcryogencryogenesiscryogenian
cryogeniccryogenic liquidcryogenicallycryogenics
cryogeninecryogenycryoglobulincryoglobulinemia
cryoglobulinscryohydratecryohydriccryokinesis
cryolathecryolitecryolithionitecryolitic
cryomagneticcryometercryometriccryometry
cryomicrographcryomicroscopiccryomicroscopycryomodule
cryoniccryonicscryopathycryopelagic
cryophiliccryophobiacryophoruscryophysics
cryophytecryoplanktoncryoportcryoprecipitate
cryopreservationcryopreservecryopreservedcryopreserving
cryoprobecryoprotectcryoprotectedcryoprotection
cryoprotective agen…cryopumpcryopyrincryopyrin-associate…
cryoregimecryosamplingcryoscopecryoscopic
cryoscopycryosectioncryosectionedcryosectioning
cryosleepcryosolventcryospherecryospheric
cryostasiscryostatcryostaticcryosurgeon
cryosurgerycryosurgicalcryosurgicallycryotechnology
cryotemperaturecryotherapistcryotherapycryotomographic
cryotomographycryotrapcryotrappingcryotron
cryoturbationcryoultramicrotomycryovialcryovolcanic
cryovolcanismcryovolcanocryoxtract instrume…cryppie
crypsiscryptcryptacanthodescryptacanthodes mac…
cryptalcryptanalysiscryptanalystcryptanalytic
cryptanalyticscryptandcryptarithmcryptate
crypticcryptic colorationcryptic crosswordcryptical
crypticallycrypticitycryptidcryptidine
cryptlikecryptocrypto-crypto-fascism
crypto-fascistcrypto-fascisticcrypto-revisionismcryptobiont
cryptobiosiscryptobioticcryptobranchiatacryptobranchiate
cryptobranchidaecryptobranchuscryptobranchus alle…cryptocarya
cryptocercidaecryptocercuscryptochannelcryptochiral
cryptochiralitycryptochromecryptochromescryptococcal
cryptococcosiscryptococcuscryptococcus gattiicryptococcus neofor…
cryptocorynecryptocracycryptocrystallinecryptodepression
cryptoexoticcryptogamcryptogamecryptogamia
cryptogamiaecryptogamiancryptogamiccryptogamist
cryptogamouscryptogeniccryptogenic organiz…cryptogenic species
cryptogramcryptogrammacryptogramma acrost…cryptogramma crispa
cryptogrammataceaecryptogrammaticcryptogrammaticallycryptograms
cryptographcryptographalcryptographercryptographic
cryptographic infor…cryptographicalcryptographicallycryptographist
cryptographycryptohalitecryptolaliacryptolect
cryptolepiscryptologiccryptologicalcryptologist
cryptologycryptomariacryptomaterialcryptomelane
cryptomeriacryptomeria japonicacryptomnesiacryptomodule
cryptomonadcryptomorphiccryptomorphismcrypton
cryptonephridialcryptonymcryptonymiccryptopart
cryptophanecryptophonecryptophthalmoscryptophyceae
cryptophytacryptophytecryptopinecryptoporticus
cryptoprocessingcryptoprocessorcryptoproctacryptoprocta ferox
cryptorchidcryptorchidismcryptorchidycryptorchism
cryptosporacryptosporidiidaecryptosporidiosiscryptosporidium
cryptosporidium par…cryptosystemcryptotermescryptotermes brevis
cryptotiscryptotis parvacryptotomographycryptoxanthin
cryptozoologicalcryptozoologistcryptozoologycrypturi
crystalcrystal ballcrystal clearcrystal counter
crystal detectorcrystal gazingcrystal healingcrystal is
crystal latticecrystal methcrystal microphonecrystal momentum
crystal oscillatorcrystal pickupcrystal pleatcrystal radio
crystal rectifiercrystal setcrystal structurecrystal tea
crystal twinningcrystal violetcrystal-clearcrystalgenomics
crystalisationcrystalisecrystalisedcrystalize
crystalizedcrystalliferouscrystallincrystalline
crystalline fructosecrystalline humourcrystalline lenscrystallinity
crystallinscrystallisationcrystallisecrystallised
crystallitecrystallizabilitycrystallizablecrystallization
crystallization, el…crystallizecrystallizedcrystallized fruit
crystallized gingercrystallizercrystallizingcrystallo-
crystalloclastcrystallogenesiscrystallogeniccrystallogenical
crystallogenycrystallogeometricalcrystallographercrystallographic
crystallographicalcrystallographicallycrystallographycrystallography, x-…
crystalloidcrystallomancycrystallometrycrystallophone
crystallurgycrystalluriacrystalplexcry_wolf
cr\u00e8checr\u00e8me anglaisecr\u00e8me br\u00fb…cr\u00e8me caramel
cr\u00e8me de cacaocr\u00e8me de cassiscr\u00e8me de la cr…cr\u00e8me de menthe
cr\u00e8me fra\u00e…cr\u00e9maill\u00e8…cr\u00eape de chinecr\u00eape paper
cr\u00eape suzettecr\u00eapy  

The Web's Largest Resource for

Definitions & Translations


A Member Of The STANDS4 Network