Found 3,151 definitions starting with CR:

crcrêpesuzettecrèchecrème
crèmedecacaocrèmedecassiscrèmedelacr&…crèmedementhe
crèmefra&ici…crèvecoeurcr.cr/che
crabcrab applecrab boilcrab burger
crab cactuscrab canoncrab cocktailcrab grass
crab legscrab louiscrab lousecrab mentality
crab nebulacrab rangooncrab spidercrab tree
crab-eatercrab-eating dogcrab-eating foxcrab-eating macaque
crab-eating opossumcrab-eating raccooncrab-eating sealcrab-plover
crab-yawscrabapplecrabapple jellycrabbe, george
crabbedcrabbedlycrabbednesscrabber
crabbilycrabbinesscrabbingcrabbish
crabbitcrabburgercrabbycrabby person
crabeatercrabeater sealcrabercrabfaced
crabgrasscrabletcrablikecrabmeat
crabronidcrabscrabsidlecrabstick
crabwisecrac!crachecracid
cracidaecrackcrack a bookcrack a crib
crack a fatcrack a smilecrack a smile... an…crack addict
crack babycrack cocainecrack downcrack down (on)
crack down oncrack ficcrack housecrack of dawn
crack of doomcrack oncrack ones fingerscrack onto
crack pipecrack rockcrack rootcrack seed
crack shotcrack throughcrack traincrack up
crack whorecrack willowcrack wisecrack-brained
crack-pipecrack-upcrackacrackable
crackbackcrackberrycrackbraincrackbrained
crackdowncrackedcracked tooth syndr…cracked wheat
cracked-wheat breadcrackednesscrackercracker bonbon
cracker boxcracker crumbscracker jackcracker jacks
cracker-barrelcrackerberrycrackerboxcrackerjack
crackerlesscrackerlikecrackerscrackhead
crackhousecrackingcracking upcrackle
crackle chinacrackle – the bes…crackleberrycrackled
cracklescracklewarecracklikecrackling
cracklinglycracklingscracklinscrackly
cracknelcrackowcrackpipecrackpot
crackpotterycrackproofcrackscracksman
cracksmencracktivismcracktrocrackup
crackwhorecrackycracky wagoncracovian
cracoviennecracowcracowescracticidae
cracticinaecracticuscradd signaling ada…cradgedness
cradlecradle capcradle catholiccradle mountain
cradle of civilizat…cradle robbercradle snatchercradle technologies
cradle-to-cradle de…cradle-to-gravecradleboardcradled
cradlelikecradlesongcradlingcraft
craft centrecraft faircraft unioncrafted
craftednesscraftercraftilycraftiness
craftlesscraftlikecrafts centrecraftsman
craftsmanlikecraftsmanlycraftsmanshipcraftsmaster
craftsmencraftspersoncraftspersonshipcraftswoman
craftswomanshipcraftsycraftworkcraftworker
craftycragcragfastcragged
craggednesscraggercraggilycragginess
craggycragscragsmancragsmen
craiccraiecraigcraig flounder
craig serani marshcraig ventnercraig, johncraig, sir thomas
craigenputtockcraigiecraigslistcraigslist inc.
craigslistercraigslistingcraikcraik, george little
craik, mrs.crailcraincraiova
craisincrakecrakeberrycraker
crakowcramcram downcram full
cram schoolcram sessioncram worldwidecram-full
crambecrambe maritimacrambe plantcrambe sponge
crambocrambucramdowncramer
cramer, johann bapt…cramlingtoncrammedcrammer
crammingcramoisiecramoisycramp
cramp ironcramp someones stylecrampbarkcramped
crampednesscrampetcrampfishcrampiness
crampingcrampitcramponcramponee
cramponscrampooncrampoonscramps
crampycramstercrancranach
cranach, lucascranachancranagecranapple
cranberriescranberrycranberry bushcranberry culture
cranberry heathcranberry juicecranberry morphemecranberry sauce
cranberry treecranberryingcranberrylikecrance
cranchcrandallitecranecrane fly
crane's billcrane's-billcrane, ichabodcrane, walter
crane-drivercranedcraneflycranelike
cranescranesbillcrangcrangon
crangonidaecranhamcraniacranial
cranial cavitycranial fontanellescranial fossa, ante…cranial fossa, midd…
cranial fossa, post…cranial indexcranial irradiationcranial nerve
cranial nerve disea…cranial nerve injur…cranial nerve neopl…cranial nerves
cranial orbitcranial sinusescranial suturescranially
craniatacraniatecranidiumcraniectomy
craningcraniocaudalcraniocerebral trau…cranioclasm
cranioclastcraniodentalcraniofacialcraniofacial abnorm…
craniofacial abnorm…craniofacial dysost…craniofaciallycraniognomy
craniologicalcraniologicallycraniologistcraniology
craniomandibularcraniomandibular di…craniometercraniometric
craniometric pointcraniometricalcraniometrycraniopagus
craniopharyngiomacraniosacralcranioscopistcranioscopy
craniosophiccraniosynostosescraniosynostosiscraniota
craniotomycranite systemscraniumcraniums
crankcrank anglecrank angle degreecrank call
crank handlecrank lettercrank outcrank science
crank upcrankbirdcrankcasecranked
crankilycrankinesscranklecrankness
crankpincrankscranksetcrankshaft
crankycranmercranmer, thomascrannied
cranniescrannockcrannogcrannoge
crannycrannyingcranstoncrant
crantaracrantscrapcrap artist
crap gamecrap on a stickcrap ones pantscrap out
crap shootingcrap upcrap-shootercrapaud
crapaud, jeancrapaudinecrapecrape fern
crape jasminecrape myrtlecrapedcrapefish
crapehangercrapelikecrapettecrapface
crapfestcrapfloodcrapgamecraphat
crapheadcrapholecraphousecraping
craploadcrapmobilecrapnelcrapola
crappercrappiecrappilycrappiness
crappitycrapplecrappletcrappo
crappycrapscrapshootcrapshooter
crapstormcraptacularcraptasticcraptastical
craptexcrapulacrapulecrapulence
crapulentcrapulentallcrapulouscrapulously
crapulousnesscrapwarecrapycraquelure
crarecrascrasecrash
crash and burncrash barriercrash boxcrash cart
crash coursecrash cymbalcrash dietcrash dive
crash gearboxcrash helmetcrash hotcrash land
crash landingcrash locator beaconcrash outcrash pad
crash position indi…crash programcrash programmecrash rescue and fi…
crash spacecrash testcrash test dummycrash trolley
crash-divecrash-helmetcrash-landcrashable
crashawcrashaw, richardcrashdumpcrashed
crashercrashingcrashinglycrashless
crashlikecrashlyticscrashpadcrashproof
crashworthinesscrashworthycrashycrasis
craspediacraspedotacraspedotecrass
crassamentcrassamentumcrassimentcrassitude
crasslycrassnesscrassostreacrassula
crassula ovatacrassulaceaecrassulaceancrassus
crassus, lucius lic…crassus, marcus lic…crastinationcrat
crataeguscrataegus aestivaliscrataegus apiifoliacrataegus biltmorea…
crataegus calpodend…crataegus coccineacrataegus coccinea …crataegus crus-galli
crataegus laevigatacrataegus marshalliicrataegus molliscrataegus monogyna
crataegus oxyacanthacrataegus oxycanthacrataegus pedicella…crataegus tomentosa
cratchcratecratedcrateful
crateloadcratercrater facecrater lake
crater lake nationa…crater moundcrateredcrateriform
cratering chargecraterlesscraterletcraterlike
craterostigmacraterouscraters of the mooncrates
cratevacratingcratinuscratippus
cratippus of athenscratolagniacratoncratonic
craturcraturelesscratyluscraugastor augusti
craunchcraunchedcraunchingcravat
cravattedcravecravedcraven
cravenedcravenettecraveningcravenly
cravennesscravercravingcravingness
crawcrawdadcrawdaddycrawdaddy!
crawfishcrawfish outcrawfordcrawford and balcar…
crawford, marioncrawford, thomascrawforditecrawk
crawlcrawl incrawl spacecrawl with
crawlablecrawledcrawlercrawley
crawlingcrawling back to youcrawling horrorcrawlspace
crawlycraxcraycraye
crayercrayer, caspar decrayettecrayfish
crayfishercrayfishermancrayfisherycrayola
crayoncrayonedcrayoningcrayonlike
craythurcrayturcrazecraze-mill
crazedcrazedlycrazednesscrazily
crazinesscrazingcrazing-millcrazy
crazy bitchcrazy bonecrazy eightscrazy eyes
crazy gluecrazy golfcrazy horsecrazy house
crazy like a foxcrazy pavingcrazy quiltcrazy weed
crazy-asscrazyweedcrccrc handbook
crécreablecreacionismocreaght
creakcreakedcreakilycreakiness
creakingcreakinglycreakle, mr.creaky
creamcream cakecream cheesecream corn
cream crackercream crackeredcream in ones jeanscream laid
cream of tartarcream of the cropcream of wheatcream off
cream piecream pitchercream puffcream sauce
cream sodacream teacream upcream violet
cream-coloredcream-colored cours…cream-facedcream-fruit
cream-of-tartar treecream-slicecream-whitecreamcake
creamcupscreamedcreamed corncreamer
creameriescreamerycreamilycreaminess
creamingcreamlesscreamlikecreampie
creamsiclecreamwarecreamycreance
creantcreasecrease-resistantcreased
creaselesscreaseproofcreasercreaseyite
creashakcreasingcreasotecreasy
creasy, sir edwardcreatcreatablecreate
create (dc)create by mental actcreate from raw mat…create from raw stu…
create mentallycreate verballycreate, read, updat…created
created bycreatescreaticcreatin
creatinecreatine kinasecreatine kinase, bb…creatine kinase, mb…
creatine kinase, mi…creatine kinase, mm…creatine phosphatecreatine phosphoric…
creatingcreating by mental …creating by removalcreating from raw m…
creating one fleshcreatinincreatininasecreatinine
creationcreation sciencecreationalcreationarily
creationarycreationismcreationistcreationistic
creativasc medicalcreativecreative accountingcreative activity
creative alliescreative artists ag…creative brain stud…creative circle adv…
creative citizencreative commonscreative commons li…creative destruction
creative differencescreative energycreative personcreative skillset
creative thinkercreative thinkingcreative workcreative writing
creativelivecreativelycreativenesscreativity
creatorcreatorlesscreatorlikecreators
creatorshipcreatresscreatrixcreatural
creaturecreature comfortcreature comfortscreature feature
creaturedomcreaturelesscreaturelikecreatureliness
creaturelycreaturescreatures of habitcreatureship
creaturizecreazecrebcreb-binding protein
crébilloncrebricostatecrebrisulcatecrebritude
crebrouscrechecrécycred
credalcredant technologiescredencecredence table
credendacredendumcredentcredential
credentialedcredentialingcredentialismcredentialization
credentialscredenzacrederitycredibility
credibility gapcrediblecrediblenesscredibly
creditcredit accountcrédit agricole co…credit analyst
credit applicationcredit bureaucredit cardcredit card fraud
credit card tartcredit crunchcredit default opti…credit default swap
credit entrycredit eventcrédit fonciercredit hour
credit limitcredit linecredit mobiliercredit note
credit ordercredit ratingcredit referencecredit report
credit riskcredit scorecredit score in the…credit sesame
credit sidecredit systemcredit transfercredit union
credit-deposit ratiocreditabilitycreditablecreditableness
creditablycreditedcreditingcreditless
créditocreditorcreditor's rightscreditors rights
creditresscreditrixcreditscreditworthiness
creditworthycredneritecredocredobaptist
credophilecredoraxcredulitivenesscredulity
credulouscredulouslycredulousnesscree
creech, kentuckycreech, williamcreedcreedal
creeditecreedlesscreedmorecreek
creek bedcreek confederacycreekfishcreekfront
creekologycreekscreeksidecreekwater
creekycreelcreelercreem
creepcreep feedcreep increep into
creep jointcreep someone outcreep upcreep up on
creepagecreepercreepethcreephole
creepiecreepifycreepilycreepiness
creepingcreeping barragecreeping bellflowercreeping bent
creeping bentgrasscreeping buglecreeping buttercupcreeping charlie
creeping crowfootcreeping elegancecreeping featurismcreeping featuritis
creeping ferncreeping jennycreeping junipercreeping lily
creeping minecreeping oxaliscreeping snowberrycreeping soft grass
creeping spike rushcreeping st john's …creeping thistlecreeping thyme
creeping willowcreeping windmill g…creeping wintergreencreeping wood sorrel
creeping zinniacreepinglycreeplecreepmeter
creepscreepycreepy-crawliescreepy-crawly
creepy-peepycreescreesecrefting
creighton, mandellcremacremaillerecremains
cremastercremastericcrematecremation
cremation chambercremationistcrematorcrematorial
crematoriescrematoriumcrematoriumscrematory
cremecreme anglaiscreme bruleecreme caramel
creme de cacaocreme de fraisecreme de menthecrème fraîche
crémieuxcremo, west virginiacremocarpcremona
cremorcremornecremosincrems
cremulatorcrenarchaealcrenarchaeoncrenarchaeota
crenarchaeotalcrenarchaeotecrenatecrenate leaf
crenatedcrenationcrenaturecrenel
crenelatecrenelatedcrenelated moldingcrenelating
crenelationcrenellatecrenellatedcrenellated moulding
crenellationcrenellecrenelledcrengle
crenic acidcrenklecrenotherapycrenshaw
crenulatecrenulatedcrenulationcreo
creodontcreolecreole statecreole-fish
creoleancreoliancreolincreolization
creolizecreoncreopointcreosol
creosotecreosote bushcreosotedcreosotelike
creosotingcrepcrepancecrepane
crepecrepe de chinecrepe ferncrepe flower
crepe gardeniacrepe jasminecrepe marocaincrepe myrtle
crepe papercrepe rubbercrepe suzettecrepelike
creperiecrepeycrepidomacrepis
crepitantcrepitatecrepitatedcrepitating
crepitationcrepitation ralecrepitouscrepitus
creponcreptcrepusclecrepuscular
crepuscular raycrepuscularitycrepuscularlycrepuscule
crepusculinecrepusculouscrepusculumcrerarite
crescrescencecrescendocrescendo bioscience
crescentcrescent citycrescent mooncrescent roll
crescent unmanned s…crescent-cell anaem…crescent-cell anemiacrescent-shaped
crescentiacrescentia cujetecrescenticcrescentini
crescentiuscrescentwisecrescivecresco
crescographcresolcresolatecresorcin
crespellecrespi, giuseppecrespinecrespo
cresscress greencress plantcresselle
cressescressetcressidacresslike
cressoncressycrestcrest cloud
crest syndromecrestatechcrestedcrested cariama
crested coral rootcrested larkcrested mynacrested penguin
crested screamercrested swiftcrested titcrested wheat grass
crested wheatgrasscrestfallencrestiecresting
crestlesscrestless wavecrestmontcrestone telecom
creswell, sir cresw…creswick, thomascresylcresylic
creta, oklahomacretaceancretaceouscretaceous period
cretaceouslycretaciouscretancretan dittany
cretecrete dittanycretiancretic
creticismcretincretinisecretinism
cretinizecretinoidcretinouscretism
cretonnecretorcretosecreusa
creusecreusot, lecreutzercreutzfeldt-jakob d…
creutzfeldt-jakob s…creutzfeldt–jakob…creuxcreuzer
crevallecrevalle jackcrevantcrevasse
crèvecœurcrevetcrevicecrevice corrosion
crevicedcreviscrewcrew chief
crew cutcrew membercrew neckcrew neckline
crew sockcrew-served weaponcrewcutcrewe
crewedcrewelcrewelworkcrewer
crewetcrewlesscrewmancrewmate
crewmembercrewneckcrewneckedcrex
crex crexcrfscrgcri de coeur
cri de coeur*cri du chat syndromecri technologiescri-du-chat syndrome
criacribcrib boardcrib death
crib mattresscrib notecrib sheetcrib-biter
crib-bitingcribbagecribbage boardcribbed
cribbercribbingcribblecribbled
cribblingcribellumcribercriblike
cribratecribrationcribriformcribriform plate
cribrosecribrouscriccricetid
cricetidaecricetinaecricetuluscricetus
cricetus cricetuscrichtoncrichton, jamescrichtonite
cricifycrickcricketcricket ball
cricket batcricket equipmentcricket fieldcricket frog
cricket groundcricket matchcricket pitchcricket whites
cricket-bat willowcricketercricketingcricketless
cricketscricketycricoidcricoid cartilage
cricondenthermcricothyroidcricothyroidotomycriddleite
criedcrieffcriercries
criestcrigancrigler-najjar synd…crigler–najjar sy…
crikeycrilecrilloncrim
crimblecrimbocrimecrime against human…
crime against naturecrime analysiscrime and punishmentcrime fiction
crime lordcrime of passioncrime preventioncrime rate
crime scenecrime statisticscrime syndicatecrime victims
crime wavecrime-riddencrimeacrimea-congo hemorr…
crimeancrimean peninsulacrimean tatarcrimean war
crimebustercrimebustingcrimefightercrimefighting
crimefreecrimefulcrimelesscrimelike
crimereportscrimeriddencrimescrimes against huma…
crimethinc.crimethinkcrimewarecrimewatch us
crimewavecrimidinecriminalcriminal activity
criminal congresscriminal contemptcriminal conversati…criminal court
criminal intelligen…criminal intentcriminal investigat…criminal justice
criminal lawcriminal negligencecriminal offencecriminal possession
criminal procedurecriminal prosecutioncriminal psychologi…criminal psychology
criminal recordcriminal suitcriminalisationcriminalise
criminalismcriminalistcriminalisticscriminality
criminalizationcriminalizecriminallycriminalness
criminaloidcriminalscriminatecriminated
criminatingcriminationcriminativecriminatory
criminicriminogenicallycriminol.criminological
criminologistcriminologycriminouscriminousness
criminycrimosincrimpcrimpage
crimpedcrimpercrimpingcrimple
crimpledcrimplingcrimpnesscrimpy
crimsoncrimson clovercrimson glorycrimson hexagon
crimson informaticscrimsonedcrimsoningcrimsonly
crimsonnesscrinalcrinan canalcrinated
crinatorycrincumcrincum-crancumcrined
crinelcrinetcringecringeling
cringemakingcringercringeworthycringing
cringinglycringingnesscringlecringy
criniculturalcrinierecrinigerouscrinion
crinitalcrinitecrinitorycrinivirus
crinklecrinkle rootcrinkle-rootcrinkled
crinklerootcrinklinesscrinklingcrinkly
crinkycrinoidcrinoidalcrinoidea
crinoideancrinolinecrinolinedcrinose
crinositycrinumcrioboliumcriollo
criollo peoplecriosphinxcrioulocrip
cripescripplecripple creekcrippled
crippled insidecripplenesscripplercrippleware
cripplingcripplinglycripplycrips
criptcriscocrisescrisis
crisis action plann…crisis centercrisis interventioncrisis management
crisis negotiationcrisis-riddencrispcrisp bread
crispatecrispatedcrispationcrispature
crispbreadcrispedcrispencrisper
crisphead lettucecrispi, francescocrispilycrispin
crispin and crispin…crispinesscrispingcrisply
crispnesscrispscrispuscrispus attucks: a …
crispycrispy gamercrispy!criss cross
criss-crosscriss-cross applesa…crissacrissal
crisscrosscrisscross heartcrisscross-rowcrisscrossed
crissumcristcristacristal
cristalinacristallocristallologycristate
cristiano ronaldocristinacristo redentorcristobal
cristobal balenciagacristóbal carbinecristobal coloncristobalite
cristoforo colombocritcrit.critchfield
criteriacriterialcriterioncriterional
criterionlesscriterionscriteriorcriterium
crithcrithidiacrithidia fascicula…crithomancu
crithomancycritiascriticcritical
critical acclaimcritical analysiscritical anglecritical appraisal
critical assetcritical asset listcritical capabilitycritical care
critical conditioncritical control po…critical diagnosticscritical discourse …
critical functioncritical illnesscritical informationcritical infrastruc…
critical inquirycritical intelligen…critical itemcritical item list
critical joint duty…critical literacycritical masscritical media
critical micelle co…critical occupation…critical opalescencecritical path
critical path methodcritical pathwayscritical periodcritical period (ps…
critical pointcritical practicecritical rationalismcritical requirement
critical reviewcritical reynolds n…critical sectioncritical speed
critical supplies a…critical sustainabi…critical technologi…critical theory
critical thinkingcritical tide levelcritical updatecritical value
critical vulnerabil…criticalitycriticality assessm…critically
critically acclaimedcriticalmetricscriticalnesscriticaster
criticisablecriticisecriticisedcriticiser
criticisingcriticismcriticisms of globa…criticizable
criticizationcriticizecriticizercriticizingly
criticocriticproofcriticscritique
critique^itcrititechcritoncritter
critter sittercrittercismcritterscrius
crix labscrixivancrizzelcrizzle
crizzledcrk-associated subs…crlfcrm software
crna goracrngedcrocroûte
cro-magnoncro-quettecroaghcroak
croakedcroakercroakingcroaky
croatcroatiacroatiancroatian peasant pa…
croatian sheepdogcroato-serbiancroatscroa`tia and slavon…
croccrocacincrocanthemum canade…croce
croceincroceouscrocethiacrocethia alba
crocetincrochecrochetcrochet hook
crochet needlecrochet stitchcrochetedcrocheter
crochetingcrochetworkcrochucrociary
crocidolitecrocincrockcrock of gold
crock of shitcrock potcrock upcrocked
crockercrockerscrockerycrocket
crocketedcrocketingcrockettcrockett, samuel ru…
crockingcrockpotcrockycrocodile
crocodile birdcrocodile clipcrocodile rivercrocodile tear
crocodile tearscrocodilelikecrocodiliacrocodilian
crocodilian reptilecrocodilitycrocodiluscrocodoc
crocodyliacrocodylidaecrocodyliformcrocodylomorph
crocodyluscrocodylus niloticuscrocodylus porosuscrocoisite
crocoitecrocolitecroconatecroconazole
croconiccroconic acidcrocosecrocosmia
crocottacrocscrocuscrocus sativus
crocus technologycrocuslikecrocutacrocuta crocuta
croesuscroftcroftercrofting
croftlandcrohncrohn diseasecrohn's disease
crohns diseasecroirecroiscroisade
croisadocroisecroissantcroissante
croissantlikecrois\u00e9croix de guerrecroker
croker, john wilsoncroker, t. croftoncroll, jamescroly, george
cromcromacromagnoncromakalim
cromarcromartycromecrome, john
cromlechcromniomancycromoglicatecromoglicic acid
cromoglycatecromolyncromolyn sodiumcromorna
cromornecromptoncrompton urban dist…crompton, samuel
cromulentcromwellcromwell (oliver)cromwell, oliver
cromwell, richardcromwell, thomascromwelliancronartium
cronartium ribicolacronecronelcronelike
cronenbergiancronetcroniancronies
cronkcronocronotecronstadt
cronstedtitecrontabcronuscronusite
cronycronyismcronyisticcroo monkey
croodlecrookcrook and nannycrookack
crookbackcrookbackedcrookbillcrooked
crooked-stemmed ast…crookedlycrookednesscrooken
crookerycrookescrookes radiometercrookes tube
crookes, williamcrookesitecrookingcrookneck
crookneck squashcrookscrooncrooned
croonercrooningcroonycrop
crop circlecrop failurecrop outcrop residue
crop rotationcrop topcrop upcrop ventures
crop-dustingcrop-earcrop-earedcrop-tailed
cropboundcropdustercropecropful
croplandcroplandscroplikecroppable
croppedcroppercroppingcrops, agricultural
cropsickcropupcroque-madamecroque-monsieur
croquembouchecroquetcroquet ballcroquet equipment
croquet malletcroquetacroquetedcroqueting
croquetlikecroquettecroquiscrore
crorepaticrosbycroscarmellosecrosier
crosieredcrosletcrosnecrospovidone
crosscross a bridge befo…cross batcross bit
cross buncross channelcross checkcross circulation
cross compilercross connectioncross countrycross cover version
cross crossletcross dressingcross examinationcross examine
cross fellcross firecross florycross hair
cross hairscross infectioncross junctioncross matching
cross merchandisingcross multiplycross of calvarycross of gold
cross of gold speechcross of lorrainecross offcross one's eyes
cross one's fingerscross ones armscross ones fingerscross ones heart
cross oneselfcross outcross overcross paths
cross patt\u00e9ecross peen hammercross pixel mediacross post
cross productcross protectioncross purposecross purposes
cross questioncross reactionscross referencecross roads
cross seacross sectioncross someones palmcross someones path
cross streetcross swordscross tabcross tabulation
cross talkcross tellcross that bridge w…cross the aisle
cross the floorcross the linecross the rubiconcross thwart
cross vinecross windcross wirecross, mrs.
cross, southerncross, victoriacross-cross-action
cross-armedcross-bandedcross-bearercross-bedding
cross-benchcross-benchercross-birthcross-border
cross-bredcross-breedcross-breedingcross-browser
cross-buncross-capcross-channelcross-check
cross-classificationcross-compatiblecross-connecting bo…cross-console emula…
cross-contaminatecross-contaminationcross-correlationcross-country
cross-country jumpi…cross-country ridingcross-country skiingcross-cousin
cross-crossletcross-culturalcross-cultural comp…cross-cutting
cross-dayscross-divisioncross-dockingcross-dress
cross-dressercross-dressingcross-examinationcross-examine
cross-examinedcross-examinercross-examiningcross-eye
cross-eyedcross-fertilecross-fertilisationcross-fertilise
cross-fertilizationcross-fertilizecross-filecross-fire
cross-fostercross-fosteringcross-garnetcross-grained
cross-indexcross-infectioncross-jack yardcross-lag
cross-leaved heathcross-leggedcross-levelingcross-light
cross-linguisticcross-linguisticallycross-linkcross-linkage
cross-linkedcross-linking reage…cross-loading (pers…cross-magnetizing e…
cross-modalcross-multiplicationcross-multiplycross-over block
cross-over studiescross-partycross-patchcross-pawl
cross-phrasingcross-platformcross-plycross-pollinate
cross-pollinatingcross-pollinationcross-primingcross-purpose
cross-questioncross-questionedcross-questionercross-questioning
cross-ratiocross-reactcross-reactioncross-reactivity
cross-readingcross-refercross-referencecross-resistance
cross-sectioncross-sectionalcross-sectional stu…cross-sell
cross-sellingcross-sententialcross-servicingcross-shaped
cross-spalecross-spallcross-springercross-staff
cross-stitchcross-stitchercross-stonecross-tab
cross-tailcross-targeting (nu…cross-tiecross-tining
cross-tolerancecross-towncross-traincross-training
cross-treescross-validationcross-vaultingcross-week
crossbandcrossbandingcrossbarcrossbarred
crossbeakcrossbeamcrossbeam systemscrossbench
crossbenchercrossbenchescrossbillcrossbite
crossbodycrossbonescrossborderscrossbow
crossbow technologi…crossbowercrossbowmancrossbracing
crossbredcrossbreedcrossbreedercrossbreeding
crossbuckcrosscheckcrosschxcrossclaim
crossclasscrosscorrelationcrosscoupledcrosscoupling
crosscourtcrosscurrentcrosscutcrosscut saw
crosscuttingcrossecrosse, andrewcrossectional
crossedcrossed eyecrossed fingerscrossed loop sensor
crossed outcrossercrossettecrosseyed
crossfadecrossfadercrossfeedcrossfiber
crossfieldcrossfirecrossfirst bankcrossfish
crossflowcrossgendercrossgradecrossgrained
crossguardcrosshaircrosshairscrosshatch
crosshatchedcrosshatchingcrossheadcrossheading
crossingcrossing areacrossing automationcrossing guard
crossing numbercrossing overcrossing over, gene…crossing the line
crossing wirescrossingscrossjackcrosslegged
crossletcrosslicensecrosslightcrosslike
crosslinearcrosslinearlycrosslinguisticcrosslink
crosslinkercrossloadcrossloopcrosslots
crosslycrossmatchcrossmatchedcrossmember
crossmetathesiscrossnathcrossnationalcrossness
crossopterygiancrossopterygiicrossovercrossover dribble
crossover health ma…crossover votecrossover votercrossovers
crosspatchcrosspiececrosspipecrossplay
crossplayercrosspointcrosspostcrossposter
crossraguelcrossrangecrossreactcrossreaction
crossreactivecrossrefcrossroadcrossroads
crossroads systemscrossrowcrossruffcrosstab
crosstalkcrosstiecrosstowncrosstree
crosstreescrosstxcrosswalkcrossway
crosswayscrossways, dorsetcrosswindcrosswise
crosswordcrossword (puzzle)crossword puzzlecrosswordlike
crossworld warrantycrosswortcrostatacrostini
crotalcrotalariacrotalaria sagitall…crotalaria spectabi…
crotalid venomscrotalidaecrotalinecrotalo
crotalumcrotaluscrotalus adamanteuscrotalus atrox
crotalus cerastescrotalus horridus a…crotalus horridus h…crotalus lepidus
crotalus mitchelliicrotalus scutulatuscrotalus tigriscrotalus viridis
crotamitoncrotanaldehydecrotaphioncrotaphite
crotaphiticcrotaphytuscrotchcrotch fruit
crotch haircrotch rocketcrotch, williamcrotched
crotchescrotchetcrotchet restcrotcheted
crotchetinesscrotchetycrotchlesscroton
croton bugcroton eluteriacroton oilcroton tiglium
crotonacrotonaldehydecrotonamidecrotonate
crotonatescrotonbugcrotonecrotonic
crotonic acidcrotonic acidscrotoninecrotonylene
crotophagacrotoxincrottalcrottle
crottlescrotylcrotylationcrotylboration
crouchcrouch downcrouchedcroucher
crouchingcroudcroukecroup
croupadecroupalcroupecrouper
croupiercroupier's rakecroupierecroupiness
croupouscroupycrousecroustade
croutcroutoncrouzon syndromecrow
crow blackbirdcrow corncrow garliccrow pheasant
crow pointcrow scarercrow stepcrow's feet
crow's footcrow's nestcrow's-feetcrow's-foot
crow's-nestcrow-baitcrow-quillcrow-silk
crow-troddencrowbaitcrowbarcrowbar hotel
crowberrycrowberry familycrowdcrowd art
crowd catchcrowd controlcrowd intocrowd out
crowd playcrowd sciencecrowd supplycrowd surfer
crowd surfingcrowd technologiescrowd togethercrowd up
crowd-poisoningcrowdboostercrowdcastcrowdcompass
crowdcomputing syst…crowdedcrowdengineeringcrowder
crowderscrowdfeedcrowdflikcrowdflower
crowdfundercrowdfundingcrowdgathercrowdhall
crowdiecrowdingcrowdlikecrowdly
crowdmedcrowdmobcrowdopticcrowdpleaser
crowdrisecrowdscrowdslingcrowdsource
crowdsourcedcrowdsourcingcrowdspringcrowdstar
crowdstrikecrowdtapcrowdtiltcrowdtwist
crowdvancecrowdycrowdzonecrowdzu
crowe, eyre evanscrowe, sir james ar…croweatercrowed
crowflowercrowfootcrowfoot familycrowfoot grass
crowingcrowkeepercrowleycrowleyan
crowlikecrowncrown beardcrown bioscience
crown cactuscrown colonycrown compoundscrown court
crown daisycrown estatecrown ethercrown ethers
crown firecrown flowercrown gallcrown glass
crown graftingcrown greencrown green bowlscrown imperial
crown in towncrown jewelcrown jewelscrown land
crown lengtheningcrown lenscrown mammalcrown molding
crown monkeycrown of thornscrown officecrown point
crown princecrown princesscrown roastcrown saw
crown sidecrown vetchcrown viccrown ward
crown wartcrown wheelcrown-beardcrown-imperial
crown-of-the-fieldcrown-postcrown-rump lengthcrown-saw
crownbeardcrowne, johncrownedcrowned crane
crowned headcrowned pigeoncrownedstcrowner
crownetcrowningcrownlesscrownlet
crownlikecrownpeakcrownpiececrowns
crownworkcrowscrows feetcrows foot
crows nestcrowstepcrowstonecrowth
crowther, samuel ad…crowtoecroycroydon
croydon faceliftcroylstonecroyncroys
crozecroze ironcroziercroziered
crpcrs reprocessing se…crtcrt screen
crtscrucrubeenscruces
cruces, cubacrucialcrucialitycrucially
cruciancrucian carpcruciatecruciate sulcus
cruciationcruciblecrucible steelcrucible, electric
crucifercruciferaecruciferouscruciferous plant
cruciferous vegetab…crucifiedcrucifiercrucifix
crucifix fishcrucifixescrucifixioncrucifixionlike
crucifixlikecruciformcrucifycrucifying
crucigerouscruciverbalismcruciverbalistcruck
crudcruddinesscruddlecruddy
crudecrude oilcrude sapcrude-oil
crudelycruden, alexandercrudenesscrudités
cruditiescruditycrudlecrudos
crudwarecrudycruelcruel and unusual p…
cruel plantcruella de vilcruellycruelness
cruelscrueltiescrueltycruentaren
cruentatecruentouscruetcruet-stand
cruftcruft togethercruftscruftsmanship
cruftycruikshankcruikshank, georgecruis
cruisecruise controlcruise linecruise liner
cruise missilecruise shipcruisedcruiselike
cruisercruiserweightcruisewearcruisewise
cruisingcruising altitudecruising levelcruisy
cruivecrullcrullercrum
crumbcrumb cakecrumb downcrumbcloth
crumbedcrumbercrumbilycrumbiness
crumbingcrumblablecrumblecrumbled
crumblercrumblesscrumbletcrumblike
crumblinesscrumblingcrumblinglycrumblings
crumblycrumbscrumbumcrumby
crumcakecrumenalcrumhorncrummable
crummilycrumminesscrummockcrummy
crumpcrumpetcrumpinesscrumple
crumple zonecrumpledcrumplednesscrumpler
crumplingcrumplycrumpycrunch
crunch numberscrunch timecrunchablecrunched
crunchercrunchinesscrunchingcrunchingly
crunchycrunchyrollcrunkcrunkle
crunodalcrunodecruorcruorin
crupcruppercruracrural
crurophiliacrurotarsalcruscrusade
crusadedcrusadercrusaderlikecrusaders
crusadescrusades, thecrusadingcrusado
crusecruse, illinoiscrusetcrush
crush hatcrush oncrush on youcrush out
crush partycrush roomcrush syndromecrushable
crushblvdcrushedcrushed leathercrushed rock
crushed sugarcrusheecrushercrusher gauge
crushingcrushinglycrushpathcrushproof
crusoe, robinsoncrustcrustacrustacea
crustaceancrustacean larvaecrustaceologicalcrustaceologist
crustaceologycrustaceouscrustaceousnesscrustal
crustal movementcrustal platecrustalogicalcrustalogist
crustalogycrustatedcrustationcrusted
crustiecrustiescrustificcrustily
crustinesscrustingcrustlesscrustlike
crustosecrustose thalluscrustquakecrusty
crutcrutchcrutchedcrutches
crutchlikecruthcruttercrux
crux australiscrux biomedicalcrux gammatacrux of the matter
crux simplexcruxescruyff turncruz records
cruzacruzadocruzadoscruzan
cruzeirocrwthcrycry all the way to …
cry blue murdercry downcry forcry for help
cry havoccry in ones beercry like a babycry like a little g…
cry me a rivercry offcry ones eyes outcry out
cry out againstcry out forcry someone a rivercry the blues
cry unclecry uncle!cry wolfcry-baby
cry-baby treecryaesthesiacryalcrybaby
crybaby treecryercryesthesiacryin'
cryingcrying birdcrying callcrying shame
cryo-cryo-electron micro…cryo-transmissioncryo-transmission e…
cryoablationcryoactivationcryoanaesthesiacryoanesthesia
cryobenchcryobiologicalcryobiologistcryobiology
cryobiosiscryobioticcryobuffercryocardioplegia
cryocauterycryochreptcryocondensationcryoconite
cryocooledcryocoolercryocoolingcryocrystallography
cryodetectorcryoelectroncryoelectron micros…cryoelectroncs
cryoelectroniccryoelectronicscryofixationcryofixed
cryofocuscryofocusingcryogencryogenesis
cryogeniancryogeniccryogenic liquidcryogenically
cryogenicscryogeninecryogenycryoglobulin
cryoglobulinemiacryoglobulinscryohydratecryohydric
cryokinesiscryolathecryolitecryolithionite
cryoliticcryomagneticcryometercryometric
cryometrycryomicrographcryomicroscopiccryomicroscopy
cryomodulecryoniccryonicscryopathy
cryopelagiccryophiliccryophobiacryophorus
cryophysicscryophytecryoplanktoncryoport
cryoprecipitatecryopreservationcryopreservecryopreserved
cryopreservingcryoprobecryoprotectcryoprotected
cryoprotectioncryoprotective agen…cryopumpcryopyrin
cryopyrin-associate…cryoregimecryosamplingcryoscope
cryoscopiccryoscopycryosectioncryosectioned
cryosectioningcryosleepcryosolventcryosphere
cryosphericcryostasiscryostatcryostatic
cryosurgeoncryosurgerycryosurgicalcryosurgically
cryotechnologycryotemperaturecryotherapistcryotherapy
cryotomographiccryotomographycryotrapcryotrapping
cryotroncryoturbationcryoultramicrotomycryovial
cryovolcaniccryovolcanismcryovolcanocryoxtract instrume…
cryppiecrypsiscryptcryptacanthodes
cryptacanthodes mac…cryptalcryptanalysiscryptanalyst
cryptanalyticcryptanalyticscryptandcryptarithm
cryptatecrypticcryptic colorationcryptic crossword
crypticalcrypticallycrypticitycryptid
cryptidinecryptlikecryptocrypto-
crypto-fascismcrypto-fascistcrypto-fascisticcrypto-revisionism
cryptobiontcryptobiosiscryptobioticcryptobranchiata
cryptobranchiatecryptobranchidaecryptobranchuscryptobranchus alle…
cryptocaryacryptocercidaecryptocercuscryptochannel
cryptochiralcryptochiralitycryptochromecryptochromes
cryptococcalcryptococcosiscryptococcuscryptococcus gattii
cryptococcus neofor…cryptocorynecryptocracycryptocrystalline
cryptodepressioncryptoexoticcryptogamcryptogame
cryptogamiacryptogamiaecryptogamiancryptogamic
cryptogamistcryptogamouscryptogeniccryptogenic organiz…
cryptogenic speciescryptogramcryptogrammacryptogramma acrost…
cryptogramma crispacryptogrammataceaecryptogrammaticcryptogrammatically
cryptogramscryptographcryptographalcryptographer
cryptographiccryptographic infor…cryptographicalcryptographically
cryptographistcryptographycryptohalitecryptolalia
cryptolectcryptolepiscryptologiccryptological
cryptologistcryptologycryptomariacryptomaterial
cryptomelanecryptomeriacryptomeria japonicacryptomnesia
cryptomodulecryptomonadcryptomorphiccryptomorphism
cryptoncryptonephridialcryptonymcryptonymic
cryptopartcryptophanecryptophonecryptophthalmos
cryptophyceaecryptophytacryptophytecryptopine
cryptoporticuscryptoprocessingcryptoprocessorcryptoprocta
cryptoprocta feroxcryptorchidcryptorchidismcryptorchidy
cryptorchismcryptosporacryptosporidiidaecryptosporidiosis
cryptosporidiumcryptosporidium par…cryptosystemcryptotermes
cryptotermes breviscryptotiscryptotis parvacryptotomography
cryptoxanthincryptozoologicalcryptozoologistcryptozoology
crypturicrystalcrystal ballcrystal clear
crystal countercrystal detectorcrystal gazingcrystal healing
crystal iscrystal latticecrystal methcrystal microphone
crystal momentumcrystal oscillatorcrystal pickupcrystal pleat
crystal radiocrystal rectifiercrystal setcrystal structure
crystal teacrystal twinningcrystal violetcrystal-clear
crystalgenomicscrystalisationcrystalisecrystalised
crystalizecrystalizedcrystalliferouscrystallin
crystallinecrystalline fructosecrystalline humourcrystalline lens
crystallinitycrystallinscrystallisationcrystallise
crystallisedcrystallitecrystallizabilitycrystallizable
crystallizationcrystallization, el…crystallizecrystallized
crystallized fruitcrystallized gingercrystallizercrystallizing
crystallo-crystalloclastcrystallogenesiscrystallogenic
crystallogenicalcrystallogenycrystallogeometricalcrystallographer
crystallographiccrystallographicalcrystallographicallycrystallography
crystallography, x-…crystalloidcrystallomancycrystallometry
crystallophonecrystallurgycrystalluriacrystalplex
cry_wolfcr\u00e8checr\u00e8me anglaisecr\u00e8me br\u00fb…
cr\u00e8me caramelcr\u00e8me de cacaocr\u00e8me de cassiscr\u00e8me de la cr…
cr\u00e8me de menthecr\u00e8me fra\u00e…cr\u00e9maill\u00e8…cr\u00eape de chine
cr\u00eape papercr\u00eape suzettecr\u00eapy 

The Web's Largest Resource for

Definitions & Translations


A Member Of The STANDS4 Network