Found 3,148 definitions starting with CR:

crcrêpesuzettecrèchecrème
crèmedecacaocrèmedecassiscrèmedelacr&…crèmedementhe
crèmefra&ici…crèvecoeurcr.cr/che
crabcrab applecrab boilcrab burger
crab cactuscrab canoncrab cocktailcrab grass
crab legscrab louiscrab lousecrab mentality
crab nebulacrab rangooncrab spidercrab tree
crab-eatercrab-eating dogcrab-eating foxcrab-eating macaque
crab-eating opossumcrab-eating raccooncrab-eating sealcrab-plover
crab-yawscrabapplecrabapple jellycrabbe, george
crabbedcrabbedlycrabbednesscrabber
crabbilycrabbinesscrabbingcrabbish
crabbitcrabburgercrabbycrabby person
crabeatercrabeater sealcrabercrabfaced
crabgrasscrabletcrablikecrabmeat
crabronidcrabscrabsidlecrabstick
crabwisecrac!crachecracid
cracidaecrackcrack a bookcrack a crib
crack a fatcrack a smilecrack a smile... an…crack addict
crack babycrack cocainecrack downcrack down (on)
crack down oncrack ficcrack housecrack of dawn
crack of doomcrack oncrack ones fingerscrack onto
crack pipecrack rockcrack rootcrack seed
crack shotcrack throughcrack traincrack up
crack whorecrack willowcrack wisecrack-brained
crack-pipecrack-upcrackacrackable
crackbackcrackberrycrackbraincrackbrained
crackdowncrackedcracked tooth syndr…cracked wheat
cracked-wheat breadcrackednesscrackercracker bonbon
cracker boxcracker crumbscracker jackcracker jacks
cracker-barrelcrackerberrycrackerboxcrackerjack
crackerlesscrackerlikecrackerscrackhead
crackhousecrackingcracking upcrackle
crackle chinacrackle – the bes…crackleberrycrackled
cracklescracklewarecracklikecrackling
cracklinglycracklingscracklinscrackly
cracknelcrackowcrackpipecrackpot
crackpotterycrackproofcrackscracksman
cracksmencracktivismcracktrocrackup
crackwhorecrackycracky wagoncracovian
cracoviennecracowcracowescracticidae
cracticinaecracticuscradd signaling ada…cradgedness
cradlecradle capcradle catholiccradle mountain
cradle of civilizat…cradle robbercradle snatchercradle technologies
cradle-to-cradle de…cradle-to-gravecradleboardcradled
cradlelikecradlesongcradlingcraft
craft centrecraft faircraft unioncrafted
craftednesscraftercraftilycraftiness
craftlesscraftlikecrafts centrecraftsman
craftsmanlikecraftsmanlycraftsmanshipcraftsmaster
craftsmencraftspersoncraftspersonshipcraftswoman
craftswomanshipcraftsycraftworkcraftworker
craftycragcragfastcragged
craggednesscraggercraggilycragginess
craggycragscragsmancragsmen
craiccraiecraigcraig flounder
craig serani marshcraig ventnercraig, johncraig, sir thomas
craigenputtockcraigiecraigslistcraigslist inc.
craigslistercraigslistingcraikcraik, george little
craik, mrs.crailcraincraiova
craisincrakecrakeberrycraker
crakowcramcram downcram full
cram schoolcram sessioncram worldwidecram-full
crambecrambe maritimacrambe plantcrambe sponge
crambocrambucramdowncramer
cramer, johann bapt…cramlingtoncrammedcrammer
crammingcramoisiecramoisycramp
cramp ironcramp someones stylecrampbarkcramped
crampednesscrampetcrampfishcrampiness
crampingcrampitcramponcramponee
cramponscrampooncrampoonscramps
crampycramstercrancranach
cranach, lucascranachancranagecranapple
cranberriescranberrycranberry bushcranberry culture
cranberry heathcranberry juicecranberry morphemecranberry sauce
cranberry treecranberryingcranberrylikecrance
cranchcrandallitecranecrane fly
crane's billcrane's-billcrane, ichabodcrane, walter
crane-drivercranedcraneflycranelike
cranescranesbillcrangcrangon
crangonidaecranhamcraniacranial
cranial cavitycranial fontanellescranial fossa, ante…cranial fossa, midd…
cranial fossa, post…cranial indexcranial irradiationcranial nerve
cranial nerve disea…cranial nerve injur…cranial nerve neopl…cranial nerves
cranial orbitcranial sinusescranial suturescranially
craniatacraniatecranidiumcraniectomy
craningcraniocaudalcraniocerebral trau…cranioclasm
cranioclastcraniodentalcraniofacialcraniofacial abnorm…
craniofacial abnorm…craniofacial dysost…craniofaciallycraniognomy
craniologicalcraniologicallycraniologistcraniology
craniomandibularcraniomandibular di…craniometercraniometric
craniometric pointcraniometricalcraniometrycraniopagus
craniopharyngiomacraniosacralcranioscopistcranioscopy
craniosophiccraniosynostosescraniosynostosiscraniota
craniotomycranite systemscraniumcraniums
crankcrank anglecrank angle degreecrank call
crank handlecrank lettercrank outcrank science
crank upcrankbirdcrankcasecranked
crankilycrankinesscranklecrankness
crankpincrankscranksetcrankshaft
crankycranmercranmer, thomascrannied
cranniescrannockcrannogcrannoge
crannycrannyingcranstoncrant
crantaracrantscrapcrap artist
crap gamecrap on a stickcrap ones pantscrap out
crap shootingcrap upcrap-shootercrapaud
crapaud, jeancrapaudinecrapecrape fern
crape jasminecrape myrtlecrapedcrapefish
crapehangercrapelikecrapettecrapface
crapfestcrapfloodcrapgamecraphat
crapheadcrapholecraphousecraping
craploadcrapmobilecrapnelcrapola
crappercrappiecrappilycrappiness
crappitycrapplecrappletcrappo
crappycrapscrapshootcrapshooter
crapstormcraptacularcraptasticcraptastical
craptexcrapulacrapulecrapulence
crapulentcrapulentallcrapulouscrapulously
crapulousnesscrapwarecrapycraquelure
crarecrascrasecrash
crash and burncrash barriercrash boxcrash cart
crash coursecrash cymbalcrash dietcrash dive
crash gearboxcrash helmetcrash hotcrash land
crash landingcrash locator beaconcrash outcrash pad
crash position indi…crash programcrash programmecrash rescue and fi…
crash spacecrash testcrash test dummycrash trolley
crash-divecrash-helmetcrash-landcrashable
crashawcrashaw, richardcrashdumpcrashed
crashercrashingcrashinglycrashless
crashlikecrashlyticscrashpadcrashproof
crashworthinesscrashworthycrashycrasis
craspediacraspedotacraspedotecrass
crassamentcrassamentumcrassimentcrassitude
crasslycrassnesscrassostreacrassula
crassula ovatacrassulaceaecrassulaceancrassus
crassus, lucius lic…crassus, marcus lic…crastinationcrat
crataeguscrataegus aestivaliscrataegus apiifoliacrataegus biltmorea…
crataegus calpodend…crataegus coccineacrataegus coccinea …crataegus crus-galli
crataegus laevigatacrataegus marshalliicrataegus molliscrataegus monogyna
crataegus oxyacanthacrataegus oxycanthacrataegus pedicella…crataegus tomentosa
cratchcratecratedcrateful
crateloadcratercrater facecrater lake
crater lake nationa…crater moundcrateredcrateriform
cratering chargecraterlesscraterletcraterlike
craterostigmacraterouscraters of the mooncrates
cratevacratingcratinuscratippus
cratippus of athenscratolagniacratoncratonic
craturcraturelesscratyluscraugastor augusti
craunchcraunchedcraunchingcravat
cravattedcravecravedcraven
cravenedcravenettecraveningcravenly
cravennesscravercravingcravingness
crawcrawdadcrawdaddycrawdaddy!
crawfishcrawfish outcrawfordcrawford and balcar…
crawford, marioncrawford, thomascrawforditecrawk
crawlcrawl incrawl spacecrawl with
crawlablecrawledcrawlercrawley
crawlingcrawling back to youcrawling horrorcrawlspace
crawlycraxcraycraye
crayercrayer, caspar decrayettecrayfish
crayfishercrayfishermancrayfisherycrayola
crayoncrayonedcrayoningcrayonlike
craythurcrayturcrazecraze-mill
crazedcrazedlycrazednesscrazily
crazinesscrazingcrazing-millcrazy
crazy bitchcrazy bonecrazy eightscrazy eyes
crazy gluecrazy golfcrazy horsecrazy house
crazy like a foxcrazy pavingcrazy quiltcrazy weed
crazy-asscrazyweedcrccrc handbook
crécreablecreacionismocreaght
creakcreakedcreakilycreakiness
creakingcreakinglycreakle, mr.creaky
creamcream cakecream cheesecream corn
cream crackercream crackeredcream in ones jeanscream laid
cream of tartarcream of the cropcream of wheatcream off
cream piecream pitchercream puffcream sauce
cream sodacream teacream upcream violet
cream-coloredcream-colored cours…cream-facedcream-fruit
cream-of-tartar treecream-slicecream-whitecreamcake
creamcupscreamedcreamed corncreamer
creameriescreamerycreamilycreaminess
creamingcreamlesscreamlikecreampie
creamsiclecreamwarecreamycreance
creantcreasecrease-resistantcreased
creaselesscreaseproofcreasercreaseyite
creashakcreasingcreasotecreasy
creasy, sir edwardcreatcreatablecreate
create (dc)create by mental actcreate from raw mat…create from raw stu…
create mentallycreate verballycreate, read, updat…created
created bycreatescreaticcreatin
creatinecreatine kinasecreatine kinase, bb…creatine kinase, mb…
creatine kinase, mi…creatine kinase, mm…creatine phosphatecreatine phosphoric…
creatingcreating by mental …creating by removalcreating from raw m…
creating one fleshcreatinincreatininasecreatinine
creationcreation sciencecreationalcreationarily
creationarycreationismcreationistcreationistic
creativasc medicalcreativecreative accountingcreative activity
creative alliescreative artists ag…creative brain stud…creative circle adv…
creative citizencreative commonscreative commons li…creative destruction
creative differencescreative energycreative personcreative skillset
creative thinkercreative thinkingcreative workcreative writing
creativelivecreativelycreativenesscreativity
creatorcreatorlesscreatorlikecreators
creatorshipcreatresscreatrixcreatural
creaturecreature comfortcreature comfortscreature feature
creaturedomcreaturelesscreaturelikecreatureliness
creaturelycreaturescreatures of habitcreatureship
creaturizecreazecrebcreb-binding protein
crébilloncrebricostatecrebrisulcatecrebritude
crebrouscrechecrécycred
credalcredant technologiescredencecredence table
credendacredendumcredentcredential
credentialedcredentialingcredentialismcredentialization
credentialscredenzacrederitycredibility
credibility gapcrediblecrediblenesscredibly
creditcredit accountcrédit agricole co…credit analyst
credit applicationcredit bureaucredit cardcredit card fraud
credit card tartcredit crunchcredit default opti…credit default swap
credit entrycredit eventcrédit fonciercredit hour
credit limitcredit linecredit mobiliercredit note
credit ordercredit ratingcredit referencecredit report
credit riskcredit scorecredit score in the…credit sesame
credit sidecredit systemcredit transfercredit union
credit-deposit ratiocreditabilitycreditablecreditableness
creditablycreditedcreditingcreditless
créditocreditorcreditor's rightscreditors rights
creditresscreditrixcreditscreditworthiness
creditworthycredneritecredocredobaptist
credophilecredoraxcredulitivenesscredulity
credulouscredulouslycredulousnesscree
creech, williamcreedcreedalcreedite
creedlesscreedmorecreekcreek bed
creek confederacycreekfishcreekfrontcreekology
creekscreeksidecreekwatercreeky
creelcreelercreemcreep
creep feedcreep increep intocreep joint
creep someone outcreep upcreep up oncreepage
creepercreepethcreepholecreepie
creepifycreepilycreepinesscreeping
creeping barragecreeping bellflowercreeping bentcreeping bentgrass
creeping buglecreeping buttercupcreeping charliecreeping crowfoot
creeping elegancecreeping featurismcreeping featuritiscreeping fern
creeping jennycreeping junipercreeping lilycreeping mine
creeping oxaliscreeping snowberrycreeping soft grasscreeping spike rush
creeping st john's …creeping thistlecreeping thymecreeping willow
creeping windmill g…creeping wintergreencreeping wood sorrelcreeping zinnia
creepinglycreeplecreepmetercreeps
creepycreepy-crawliescreepy-crawlycreepy-peepy
creescreesecreftingcreighton, mandell
cremacremaillerecremainscremaster
cremastericcrematecremationcremation chamber
cremationistcrematorcrematorialcrematories
crematoriumcrematoriumscrematorycreme
creme anglaiscreme bruleecreme caramelcreme de cacao
creme de fraisecreme de menthecrème fraîchecrémieux
cremo, west virginiacremocarpcremonacremor
cremornecremosincremscremulator
crenarchaealcrenarchaeoncrenarchaeotacrenarchaeotal
crenarchaeotecrenatecrenate leafcrenated
crenationcrenaturecrenelcrenelate
crenelatedcrenelated moldingcrenelatingcrenelation
crenellatecrenellatedcrenellated mouldingcrenellation
crenellecrenelledcrenglecrenic acid
crenklecrenotherapycrenshawcrenulate
crenulatedcrenulationcreocreodont
creolecreole statecreole-fishcreolean
creoliancreolincreolizationcreolize
creoncreopointcreosolcreosote
creosote bushcreosotedcreosotelikecreosoting
crepcrepancecrepanecrepe
crepe de chinecrepe ferncrepe flowercrepe gardenia
crepe jasminecrepe marocaincrepe myrtlecrepe paper
crepe rubbercrepe suzettecrepelikecreperie
crepeycrepidomacrepiscrepitant
crepitatecrepitatedcrepitatingcrepitation
crepitation ralecrepitouscrepituscrepon
creptcrepusclecrepuscularcrepuscular ray
crepuscularitycrepuscularlycrepusculecrepusculine
crepusculouscrepusculumcreraritecres
crescencecrescendocrescendo biosciencecrescent
crescent citycrescent mooncrescent rollcrescent unmanned s…
crescent-cell anaem…crescent-cell anemiacrescent-shapedcrescentia
crescentia cujetecrescenticcrescentinicrescentius
crescentwisecrescivecrescocrescograph
cresolcresolatecresorcincrespelle
crespi, giuseppecrespinecrespocress
cress greencress plantcressellecresses
cressetcressidacresslikecresson
cressycrestcrest cloudcrest syndrome
crestatechcrestedcrested cariamacrested coral root
crested larkcrested mynacrested penguincrested screamer
crested swiftcrested titcrested wheat grasscrested wheatgrass
crestfallencrestiecrestingcrestless
crestless wavecrestmontcrestone telecomcreswell, sir cresw…
creswick, thomascresylcresyliccreta, oklahoma
cretaceancretaceouscretaceous periodcretaceously
cretaciouscretancretan dittanycrete
crete dittanycretiancreticcreticism
cretincretinisecretinismcretinize
cretinoidcretinouscretismcretonne
cretorcretosecreusacreuse
creusot, lecreutzercreutzfeldt-jakob d…creutzfeldt-jakob s…
creutzfeldt–jakob…creuxcreuzercrevalle
crevalle jackcrevantcrevassecrèvecœur
crevetcrevicecrevice corrosioncreviced
creviscrewcrew chiefcrew cut
crew membercrew neckcrew necklinecrew sock
crew-served weaponcrewcutcrewecrewed
crewelcrewelworkcrewercrewet
crewlesscrewmancrewmatecrewmember
crewneckcrewneckedcrexcrex crex
crfscrgcri de coeurcri de coeur*
cri du chat syndromecri technologiescri-du-chat syndromecria
cribcrib boardcrib deathcrib mattress
crib notecrib sheetcrib-bitercrib-biting
cribbagecribbage boardcribbedcribber
cribbingcribblecribbledcribbling
cribellumcribercriblikecribrate
cribrationcribriformcribriform platecribrose
cribrouscriccricetidcricetidae
cricetinaecricetuluscricetuscricetus cricetus
crichtoncrichton, jamescrichtonitecricify
crickcricketcricket ballcricket bat
cricket equipmentcricket fieldcricket frogcricket ground
cricket matchcricket pitchcricket whitescricket-bat willow
cricketercricketingcricketlesscrickets
cricketycricoidcricoid cartilagecricondentherm
cricothyroidcricothyroidotomycriddleitecried
crieffcriercriescriest
crigancrigler-najjar synd…crigler–najjar sy…crikey
crilecrilloncrimcrimble
crimbocrimecrime against human…crime against nature
crime analysiscrime and punishmentcrime fictioncrime lord
crime of passioncrime preventioncrime ratecrime scene
crime statisticscrime syndicatecrime victimscrime wave
crime-riddencrimeacrimea-congo hemorr…crimean
crimean peninsulacrimean tatarcrimean warcrimebuster
crimebustingcrimefightercrimefightingcrimefree
crimefulcrimelesscrimelikecrimereports
crimeriddencrimescrimes against huma…crimethinc.
crimethinkcrimewarecrimewatch uscrimewave
crimidinecriminalcriminal activitycriminal congress
criminal contemptcriminal conversati…criminal courtcriminal intelligen…
criminal intentcriminal investigat…criminal justicecriminal law
criminal negligencecriminal offencecriminal possessioncriminal procedure
criminal prosecutioncriminal psychologi…criminal psychologycriminal record
criminal suitcriminalisationcriminalisecriminalism
criminalistcriminalisticscriminalitycriminalization
criminalizecriminallycriminalnesscriminaloid
criminalscriminatecriminatedcriminating
criminationcriminativecriminatorycrimini
criminogenicallycriminol.criminologicalcriminologist
criminologycriminouscriminousnesscriminy
crimosincrimpcrimpagecrimped
crimpercrimpingcrimplecrimpled
crimplingcrimpnesscrimpycrimson
crimson clovercrimson glorycrimson hexagoncrimson informatics
crimsonedcrimsoningcrimsonlycrimsonness
crinalcrinan canalcrinatedcrinatory
crincumcrincum-crancumcrinedcrinel
crinetcringecringelingcringemaking
cringercringeworthycringingcringingly
cringingnesscringlecringycrinicultural
crinierecrinigerouscrinioncrinital
crinitecrinitorycriniviruscrinkle
crinkle rootcrinkle-rootcrinkledcrinkleroot
crinklinesscrinklingcrinklycrinky
crinoidcrinoidalcrinoideacrinoidean
crinolinecrinolinedcrinosecrinosity
crinumcrioboliumcriollocriollo people
criosphinxcrioulocripcripes
cripplecripple creekcrippledcrippled inside
cripplenesscripplercripplewarecrippling
cripplinglycripplycripscript
criscocrisescrisiscrisis action plann…
crisis centercrisis interventioncrisis managementcrisis negotiation
crisis-riddencrispcrisp breadcrispate
crispatedcrispationcrispaturecrispbread
crispedcrispencrispercrisphead lettuce
crispi, francescocrispilycrispincrispin and crispin…
crispinesscrispingcrisplycrispness
crispscrispuscrispus attucks: a …crispy
crispy gamercrispy!criss crosscriss-cross
criss-cross applesa…crissacrissalcrisscross
crisscross heartcrisscross-rowcrisscrossedcrissum
cristcristacristalcristalina
cristallocristallologycristatecristiano ronaldo
cristinacristo redentorcristobalcristobal balenciaga
cristóbal carbinecristobal coloncristobalitecristoforo colombo
critcrit.critchfieldcriteria
criterialcriterioncriterionalcriterionless
criterionscriteriorcriteriumcrith
crithidiacrithidia fascicula…crithomancucrithomancy
critiascriticcriticalcritical acclaim
critical analysiscritical anglecritical appraisalcritical asset
critical asset listcritical capabilitycritical carecritical condition
critical control po…critical diagnosticscritical discourse …critical function
critical illnesscritical informationcritical infrastruc…critical inquiry
critical intelligen…critical itemcritical item listcritical joint duty…
critical literacycritical masscritical mediacritical micelle co…
critical occupation…critical opalescencecritical pathcritical path method
critical pathwayscritical periodcritical period (ps…critical point
critical practicecritical rationalismcritical requirementcritical review
critical reynolds n…critical sectioncritical speedcritical supplies a…
critical sustainabi…critical technologi…critical theorycritical thinking
critical tide levelcritical updatecritical valuecritical vulnerabil…
criticalitycriticality assessm…criticallycritically acclaimed
criticalmetricscriticalnesscriticastercriticisable
criticisecriticisedcriticisercriticising
criticismcriticisms of globa…criticizablecriticization
criticizecriticizercriticizinglycritico
criticproofcriticscritiquecritique^it
crititechcritoncrittercritter sitter
crittercismcritterscriuscrix labs
crixivancrizzelcrizzlecrizzled
crk-associated subs…crlfcrm softwarecrna gora
crngedcrocroûtecro-magnon
cro-quettecroaghcroakcroaked
croakercroakingcroakycroat
croatiacroatiancroatian peasant pa…croatian sheepdog
croato-serbiancroatscroa`tia and slavon…croc
crocacincrocanthemum canade…crocecrocein
croceouscrocethiacrocethia albacrocetin
crochecrochetcrochet hookcrochet needle
crochet stitchcrochetedcrochetercrocheting
crochetworkcrochucrociarycrocidolite
crocincrockcrock of goldcrock of shit
crock potcrock upcrockedcrocker
crockerscrockerycrocketcrocketed
crocketingcrockettcrockett, samuel ru…crocking
crockpotcrockycrocodilecrocodile bird
crocodile clipcrocodile rivercrocodile tearcrocodile tears
crocodilelikecrocodiliacrocodiliancrocodilian reptile
crocodilitycrocodiluscrocodoccrocodylia
crocodylidaecrocodyliformcrocodylomorphcrocodylus
crocodylus niloticuscrocodylus porosuscrocoisitecrocoite
crocolitecroconatecroconazolecroconic
croconic acidcrocosecrocosmiacrocotta
crocscrocuscrocus sativuscrocus technology
crocuslikecrocutacrocuta crocutacroesus
croftcroftercroftingcroftland
crohncrohn diseasecrohn's diseasecrohns disease
croirecroiscroisadecroisado
croisecroissantcroissantecroissantlike
crois\u00e9croix de guerrecrokercroker, john wilson
croker, t. croftoncroll, jamescroly, georgecroma
cromagnoncromakalimcromarcromarty
cromecrome, johncromlechcromniomancy
cromoglicatecromoglicic acidcromoglycatecromolyn
cromolyn sodiumcromornacromornecrompton
crompton urban dist…crompton, samuelcromulentcromwell
cromwell (oliver)cromwell, olivercromwell, richardcromwell, thomas
cromwelliancronartiumcronartium ribicolacrone
cronelcronelikecronenbergiancronet
croniancroniescronkcrono
cronotecronstadtcronstedtitecrontab
cronuscronusitecronycronyism
cronyisticcroo monkeycroodlecrook
crook and nannycrookackcrookbackcrookbacked
crookbillcrookedcrooked-stemmed ast…crookedly
crookednesscrookencrookerycrookes
crookes radiometercrookes tubecrookes, williamcrookesite
crookingcrookneckcrookneck squashcrooks
crooncroonedcroonercrooning
croonycropcrop circlecrop failure
crop outcrop residuecrop rotationcrop top
crop upcrop venturescrop-dustingcrop-ear
crop-earedcrop-tailedcropboundcropduster
cropecropfulcroplandcroplands
croplikecroppablecroppedcropper
croppingcrops, agriculturalcropsickcropup
croque-madamecroque-monsieurcroquembouchecroquet
croquet ballcroquet equipmentcroquet malletcroqueta
croquetedcroquetingcroquetlikecroquette
croquiscrorecrorepaticrosby
croscarmellosecrosiercrosieredcroslet
crosnecrospovidonecrosscross a bridge befo…
cross batcross bitcross buncross channel
cross checkcross circulationcross compilercross connection
cross countrycross cover versioncross crossletcross dressing
cross examinationcross examinecross fellcross fire
cross florycross haircross hairscross infection
cross junctioncross matchingcross merchandisingcross multiply
cross of calvarycross of goldcross of gold speechcross of lorraine
cross offcross one's eyescross one's fingerscross ones arms
cross ones fingerscross ones heartcross oneselfcross out
cross overcross pathscross patt\u00e9ecross peen hammer
cross pixel mediacross postcross productcross protection
cross purposecross purposescross questioncross reactions
cross referencecross roadscross seacross section
cross someones palmcross someones pathcross streetcross swords
cross tabcross tabulationcross talkcross tell
cross that bridge w…cross the aislecross the floorcross the line
cross the rubiconcross thwartcross vinecross wind
cross wirecross, mrs.cross, southerncross, victoria
cross-cross-actioncross-armedcross-banded
cross-bearercross-beddingcross-benchcross-bencher
cross-birthcross-bordercross-bredcross-breed
cross-breedingcross-browsercross-buncross-cap
cross-channelcross-checkcross-classificationcross-compatible
cross-connecting bo…cross-console emula…cross-contaminatecross-contamination
cross-correlationcross-countrycross-country jumpi…cross-country riding
cross-country skiingcross-cousincross-crossletcross-cultural
cross-cultural comp…cross-cuttingcross-dayscross-division
cross-dockingcross-dresscross-dressercross-dressing
cross-examinationcross-examinecross-examinedcross-examiner
cross-examiningcross-eyecross-eyedcross-fertile
cross-fertilisationcross-fertilisecross-fertilizationcross-fertilize
cross-filecross-firecross-fostercross-fostering
cross-garnetcross-grainedcross-indexcross-infection
cross-jack yardcross-lagcross-leaved heathcross-legged
cross-levelingcross-lightcross-linguisticcross-linguistically
cross-linkcross-linkagecross-linkedcross-linking reage…
cross-loading (pers…cross-magnetizing e…cross-modalcross-multiplication
cross-multiplycross-over blockcross-over studiescross-party
cross-patchcross-pawlcross-phrasingcross-platform
cross-plycross-pollinatecross-pollinatingcross-pollination
cross-primingcross-purposecross-questioncross-questioned
cross-questionercross-questioningcross-ratiocross-react
cross-reactioncross-reactivitycross-readingcross-refer
cross-referencecross-resistancecross-sectioncross-sectional
cross-sectional stu…cross-sellcross-sellingcross-sentential
cross-servicingcross-shapedcross-spalecross-spall
cross-springercross-staffcross-stitchcross-stitcher
cross-stonecross-tabcross-tailcross-targeting (nu…
cross-tiecross-tiningcross-tolerancecross-town
cross-traincross-trainingcross-treescross-validation
cross-vaultingcross-weekcrossbandcrossbanding
crossbarcrossbarredcrossbeakcrossbeam
crossbeam systemscrossbenchcrossbenchercrossbenches
crossbillcrossbitecrossbodycrossbones
crossborderscrossbowcrossbow technologi…crossbower
crossbowmancrossbracingcrossbredcrossbreed
crossbreedercrossbreedingcrossbuckcrosscheck
crosschxcrossclaimcrossclasscrosscorrelation
crosscoupledcrosscouplingcrosscourtcrosscurrent
crosscutcrosscut sawcrosscuttingcrosse
crosse, andrewcrossectionalcrossedcrossed eye
crossed fingerscrossed loop sensorcrossed outcrosser
crossettecrosseyedcrossfadecrossfader
crossfeedcrossfibercrossfieldcrossfire
crossfirst bankcrossfishcrossflowcrossgender
crossgradecrossgrainedcrossguardcrosshair
crosshairscrosshatchcrosshatchedcrosshatching
crossheadcrossheadingcrossingcrossing area
crossing automationcrossing guardcrossing numbercrossing over
crossing over, gene…crossing the linecrossing wirescrossings
crossjackcrossleggedcrossletcrosslicense
crosslightcrosslikecrosslinearcrosslinearly
crosslinguisticcrosslinkcrosslinkercrossload
crossloopcrosslotscrosslycrossmatch
crossmatchedcrossmembercrossmetathesiscrossnath
crossnationalcrossnesscrossopterygiancrossopterygii
crossovercrossover dribblecrossover health ma…crossover vote
crossover votercrosspatchcrosspiececrosspipe
crossplaycrossplayercrosspointcrosspost
crosspostercrossraguelcrossrangecrossreact
crossreactioncrossreactivecrossrefcrossroad
crossroadscrossroads systemscrossrowcrossruff
crosstabcrosstalkcrosstiecrosstown
crosstreecrosstreescrosstxcrosswalk
crosswaycrosswayscrossways, dorsetcrosswind
crosswisecrosswordcrossword (puzzle)crossword puzzle
crosswordlikecrossworld warrantycrosswortcrostata
crostinicrotalcrotalariacrotalaria sagitall…
crotalaria spectabi…crotalid venomscrotalidaecrotaline
crotalocrotalumcrotaluscrotalus adamanteus
crotalus atroxcrotalus cerastescrotalus horridus a…crotalus horridus h…
crotalus lepiduscrotalus mitchelliicrotalus scutulatuscrotalus tigris
crotalus viridiscrotamitoncrotanaldehydecrotaphion
crotaphitecrotaphiticcrotaphytuscrotch
crotch fruitcrotch haircrotch rocketcrotch, william
crotchedcrotchescrotchetcrotchet rest
crotchetedcrotchetinesscrotchetycrotchless
crotoncroton bugcroton eluteriacroton oil
croton tigliumcrotonacrotonaldehydecrotonamide
crotonatecrotonatescrotonbugcrotone
crotoniccrotonic acidcrotonic acidscrotonine
crotonylenecrotophagacrotoxincrottal
crottlecrottlescrotylcrotylation
crotylborationcrouchcrouch downcrouched
crouchercrouchingcroudcrouke
croupcroupadecroupalcroupe
croupercroupiercroupier's rakecroupiere
croupinesscroupouscroupycrouse
croustadecroutcroutoncrouzon syndrome
crowcrow blackbirdcrow corncrow garlic
crow pheasantcrow pointcrow scarercrow step
crow's feetcrow's footcrow's nestcrow's-feet
crow's-footcrow's-nestcrow-baitcrow-quill
crow-silkcrow-troddencrowbaitcrowbar
crowbar hotelcrowberrycrowberry familycrowd
crowd artcrowd catchcrowd controlcrowd into
crowd outcrowd playcrowd sciencecrowd supply
crowd surfercrowd surfingcrowd technologiescrowd together
crowd upcrowd-poisoningcrowdboostercrowdcast
crowdcompasscrowdcomputing syst…crowdedcrowdengineering
crowdercrowderscrowdfeedcrowdflik
crowdflowercrowdfundercrowdfundingcrowdgather
crowdhallcrowdiecrowdingcrowdlike
crowdlycrowdmedcrowdmobcrowdoptic
crowdpleasercrowdrisecrowdscrowdsling
crowdsourcecrowdsourcedcrowdsourcingcrowdspring
crowdstarcrowdstrikecrowdtapcrowdtilt
crowdtwistcrowdvancecrowdycrowdzone
crowdzucrowe, eyre evanscrowe, sir james ar…croweater
crowedcrowflowercrowfootcrowfoot family
crowfoot grasscrowingcrowkeepercrowley
crowleyancrowlikecrowncrown beard
crown biosciencecrown cactuscrown colonycrown compounds
crown courtcrown daisycrown estatecrown ether
crown etherscrown firecrown flowercrown gall
crown glasscrown graftingcrown greencrown green bowls
crown imperialcrown in towncrown jewelcrown jewels
crown landcrown lengtheningcrown lenscrown mammal
crown moldingcrown monkeycrown of thornscrown office
crown pointcrown princecrown princesscrown roast
crown sawcrown sidecrown vetchcrown vic
crown wardcrown wartcrown wheelcrown-beard
crown-imperialcrown-of-the-fieldcrown-postcrown-rump length
crown-sawcrownbeardcrowne, johncrowned
crowned cranecrowned headcrowned pigeoncrownedst
crownercrownetcrowningcrownless
crownletcrownlikecrownpeakcrownpiece
crownscrownworkcrowscrows feet
crows footcrows nestcrowstepcrowstone
crowthcrowther, samuel ad…crowtoecroy
croydoncroydon faceliftcroylstonecroyn
croyscrozecroze ironcrozier
crozieredcrpcrs reprocessing se…crt
crt screencrtscrucrubeens
crucescruces, cubacrucialcruciality
cruciallycruciancrucian carpcruciate
cruciate sulcuscruciationcruciblecrucible steel
crucible, electriccrucifercruciferaecruciferous
cruciferous plantcruciferous vegetab…crucifiedcrucifier
crucifixcrucifix fishcrucifixescrucifixion
crucifixionlikecrucifixlikecruciformcrucify
crucifyingcrucigerouscruciverbalismcruciverbalist
cruckcrudcruddinesscruddle
cruddycrudecrude oilcrude sap
crude-oilcrudelycruden, alexandercrudeness
cruditéscruditiescruditycrudle
crudoscrudwarecrudycruel
cruel and unusual p…cruel plantcruella de vilcruelly
cruelnesscruelscrueltiescruelty
cruentarencruentatecruentouscruet
cruet-standcruftcruft togethercrufts
cruftsmanshipcruftycruikshankcruikshank, george
cruiscruisecruise controlcruise line
cruise linercruise missilecruise shipcruised
cruiselikecruisercruiserweightcruisewear
cruisewisecruisingcruising altitudecruising level
cruisycruivecrullcruller
crumcrumbcrumb cakecrumb down
crumbclothcrumbedcrumbercrumbily
crumbinesscrumbingcrumblablecrumble
crumbledcrumblercrumblesscrumblet
crumblikecrumblinesscrumblingcrumblingly
crumblingscrumblycrumbscrumbum
crumbycrumcakecrumenalcrumhorn
crummablecrummilycrumminesscrummock
crummycrumpcrumpetcrumpiness
crumplecrumple zonecrumpledcrumpledness
crumplercrumplingcrumplycrumpy
crunchcrunch numberscrunch timecrunchable
crunchedcrunchercrunchinesscrunching
crunchinglycrunchycrunchyrollcrunk
crunklecrunodalcrunodecruor
cruorincrupcruppercrura
cruralcrurophiliacrurotarsalcrus
crusadecrusadedcrusadercrusaderlike
crusaderscrusadescrusades, thecrusading
crusadocrusecruse, illinoiscruset
crushcrush hatcrush oncrush on you
crush outcrush partycrush roomcrush syndrome
crushablecrushblvdcrushedcrushed leather
crushed rockcrushed sugarcrusheecrusher
crusher gaugecrushingcrushinglycrushpath
crushproofcrusoe, robinsoncrustcrusta
crustaceacrustaceancrustacean larvaecrustaceological
crustaceologistcrustaceologycrustaceouscrustaceousness
crustalcrustal movementcrustal platecrustalogical
crustalogistcrustalogycrustatedcrustation
crustedcrustiecrustiescrustific
crustilycrustinesscrustingcrustless
crustlikecrustosecrustose thalluscrustquake
crustycrutcrutchcrutched
crutchescrutchlikecruthcrutter
cruxcrux australiscrux biomedicalcrux gammata
crux of the mattercrux simplexcruxescruyff turn
cruz recordscruzacruzadocruzados
cruzancruzeirocrwthcry
cry all the way to …cry blue murdercry downcry for
cry for helpcry havoccry in ones beercry like a baby
cry like a little g…cry me a rivercry offcry ones eyes out
cry outcry out againstcry out forcry someone a river
cry the bluescry unclecry uncle!cry wolf
cry-babycry-baby treecryaesthesiacryal
crybabycrybaby treecryercryesthesia
cryin'cryingcrying birdcrying call
crying shamecryo-cryo-electron micro…cryo-transmission
cryo-transmission e…cryoablationcryoactivationcryoanaesthesia
cryoanesthesiacryobenchcryobiologicalcryobiologist
cryobiologycryobiosiscryobioticcryobuffer
cryocardioplegiacryocauterycryochreptcryocondensation
cryoconitecryocooledcryocoolercryocooling
cryocrystallographycryodetectorcryoelectroncryoelectron micros…
cryoelectroncscryoelectroniccryoelectronicscryofixation
cryofixedcryofocuscryofocusingcryogen
cryogenesiscryogeniancryogeniccryogenic liquid
cryogenicallycryogenicscryogeninecryogeny
cryoglobulincryoglobulinemiacryoglobulinscryohydrate
cryohydriccryokinesiscryolathecryolite
cryolithionitecryoliticcryomagneticcryometer
cryometriccryometrycryomicrographcryomicroscopic
cryomicroscopycryomodulecryoniccryonics
cryopathycryopelagiccryophiliccryophobia
cryophoruscryophysicscryophytecryoplankton
cryoportcryoprecipitatecryopreservationcryopreserve
cryopreservedcryopreservingcryoprobecryoprotect
cryoprotectedcryoprotectioncryoprotective agen…cryopump
cryopyrincryopyrin-associate…cryoregimecryosampling
cryoscopecryoscopiccryoscopycryosection
cryosectionedcryosectioningcryosleepcryosolvent
cryospherecryosphericcryostasiscryostat
cryostaticcryosurgeoncryosurgerycryosurgical
cryosurgicallycryotechnologycryotemperaturecryotherapist
cryotherapycryotomographiccryotomographycryotrap
cryotrappingcryotroncryoturbationcryoultramicrotomy
cryovialcryovolcaniccryovolcanismcryovolcano
cryoxtract instrume…cryppiecrypsiscrypt
cryptacanthodescryptacanthodes mac…cryptalcryptanalysis
cryptanalystcryptanalyticcryptanalyticscryptand
cryptarithmcryptatecrypticcryptic coloration
cryptic crosswordcrypticalcrypticallycrypticity
cryptidcryptidinecryptlikecrypto
crypto-crypto-fascismcrypto-fascistcrypto-fascistic
crypto-revisionismcryptobiontcryptobiosiscryptobiotic
cryptobranchiatacryptobranchiatecryptobranchidaecryptobranchus
cryptobranchus alle…cryptocaryacryptocercidaecryptocercus
cryptochannelcryptochiralcryptochiralitycryptochrome
cryptochromescryptococcalcryptococcosiscryptococcus
cryptococcus gattiicryptococcus neofor…cryptocorynecryptocracy
cryptocrystallinecryptodepressioncryptoexoticcryptogam
cryptogamecryptogamiacryptogamiaecryptogamian
cryptogamiccryptogamistcryptogamouscryptogenic
cryptogenic organiz…cryptogenic speciescryptogramcryptogramma
cryptogramma acrost…cryptogramma crispacryptogrammataceaecryptogrammatic
cryptogrammaticallycryptogramscryptographcryptographal
cryptographercryptographiccryptographic infor…cryptographical
cryptographicallycryptographistcryptographycryptohalite
cryptolaliacryptolectcryptolepiscryptologic
cryptologicalcryptologistcryptologycryptomaria
cryptomaterialcryptomelanecryptomeriacryptomeria japonica
cryptomnesiacryptomodulecryptomonadcryptomorphic
cryptomorphismcryptoncryptonephridialcryptonym
cryptonymiccryptopartcryptophanecryptophone
cryptophthalmoscryptophyceaecryptophytacryptophyte
cryptopinecryptoporticuscryptoprocessingcryptoprocessor
cryptoproctacryptoprocta feroxcryptorchidcryptorchidism
cryptorchidycryptorchismcryptosporacryptosporidiidae
cryptosporidiosiscryptosporidiumcryptosporidium par…cryptosystem
cryptotermescryptotermes breviscryptotiscryptotis parva
cryptotomographycryptoxanthincryptozoologicalcryptozoologist
cryptozoologycrypturicrystalcrystal ball
crystal clearcrystal countercrystal detectorcrystal gazing
crystal healingcrystal iscrystal latticecrystal meth
crystal microphonecrystal momentumcrystal oscillatorcrystal pickup
crystal pleatcrystal radiocrystal rectifiercrystal set
crystal structurecrystal teacrystal twinningcrystal violet
crystal-clearcrystalgenomicscrystalisationcrystalise
crystalisedcrystalizecrystalizedcrystalliferous
crystallincrystallinecrystalline fructosecrystalline humour
crystalline lenscrystallinitycrystallinscrystallisation
crystallisecrystallisedcrystallitecrystallizability
crystallizablecrystallizationcrystallization, el…crystallize
crystallizedcrystallized fruitcrystallized gingercrystallizer
crystallizingcrystallo-crystalloclastcrystallogenesis
crystallogeniccrystallogenicalcrystallogenycrystallogeometrical
crystallographercrystallographiccrystallographicalcrystallographically
crystallographycrystallography, x-…crystalloidcrystallomancy
crystallometrycrystallophonecrystallurgycrystalluria
crystalplexcry_wolfcr\u00e8checr\u00e8me anglaise
cr\u00e8me br\u00fb…cr\u00e8me caramelcr\u00e8me de cacaocr\u00e8me de cassis
cr\u00e8me de la cr…cr\u00e8me de menthecr\u00e8me fra\u00e…cr\u00e9maill\u00e8…
cr\u00eape de chinecr\u00eape papercr\u00eape suzettecr\u00eapy

The Web's Largest Resource for

Definitions & Translations


A Member Of The STANDS4 Network