Found 3,155 definitions starting with CR:

crcrêpesuzettecrèchecrème
crèmedecacaocrèmedecassiscrèmedelacr&…crèmedementhe
crèmefra&ici…crèvecoeurcr.cr/che
crabcrab applecrab boilcrab burger
crab cactuscrab canoncrab cocktailcrab grass
crab legscrab louiscrab lousecrab mentality
crab nebulacrab rangooncrab spidercrab tree
crab-eatercrab-eating dogcrab-eating foxcrab-eating macaque
crab-eating opossumcrab-eating raccooncrab-eating sealcrab-plover
crab-yawscrabapplecrabapple jellycrabbe, george
crabbedcrabbedlycrabbednesscrabber
crabbilycrabbinesscrabbingcrabbish
crabbitcrabburgercrabbycrabby person
crabeatercrabeater sealcrabercrabfaced
crabgrasscrabletcrablikecrabmeat
crabronidcrabscrabsidlecrabstick
crabwisecrac!crachecracid
cracidaecrackcrack a bookcrack a crib
crack a fatcrack a smilecrack a smile... an…crack addict
crack babycrack cocainecrack downcrack down (on)
crack down oncrack ficcrack housecrack of dawn
crack of doomcrack oncrack ones fingerscrack onto
crack pipecrack rockcrack rootcrack seed
crack shotcrack throughcrack traincrack up
crack whorecrack willowcrack wisecrack-brained
crack-pipecrack-upcrackacrackable
crackbackcrackberrycrackbraincrackbrained
crackdowncrackedcracked tooth syndr…cracked wheat
cracked-wheat breadcrackednesscrackercracker bonbon
cracker boxcracker crumbscracker jackcracker jacks
cracker-barrelcrackerberrycrackerboxcrackerjack
crackerlesscrackerlikecrackerscrackhead
crackhousecrackingcracking upcrackle
crackle chinacrackle – the bes…crackleberrycrackled
cracklescracklewarecracklikecrackling
cracklinglycracklingscracklinscrackly
cracknelcrackowcrackpipecrackpot
crackpotterycrackproofcrackscracksman
cracksmencracktivismcracktrocrackup
crackwhorecrackycracky wagoncracovian
cracoviennecracowcracowescracticidae
cracticinaecracticuscradd signaling ada…cradgedness
cradlecradle capcradle catholiccradle mountain
cradle of civilizat…cradle robbercradle snatchercradle technologies
cradle-to-cradle de…cradle-to-gravecradleboardcradled
cradlelikecradlesongcradlingcraft
craft centrecraft faircraft unioncrafted
craftednesscraftercraftilycraftiness
craftlesscraftlikecrafts centrecraftsman
craftsmanlikecraftsmanlycraftsmanshipcraftsmaster
craftsmencraftspersoncraftspersonshipcraftswoman
craftswomanshipcraftsycraftworkcraftworker
craftycragcragfastcragged
craggednesscraggercraggilycragginess
craggycragscragsmancragsmen
craiccraiecraigcraig flounder
craig serani marshcraig ventnercraig, johncraig, sir thomas
craigenputtockcraigiecraigslistcraigslist inc.
craigslistercraigslistingcraikcraik, george little
craik, mrs.crailcraincraiova
craisincrakecrakeberrycraker
crakowcramcram downcram full
cram schoolcram sessioncram worldwidecram-full
crambecrambe maritimacrambe plantcrambe sponge
crambocrambucramdowncramer
cramer, johann bapt…cramlingtoncrammedcrammer
crammingcramoisiecramoisycramp
cramp ironcramp someones stylecrampbarkcramped
crampednesscrampetcrampfishcrampiness
crampingcrampitcramponcramponee
cramponscrampooncrampoonscramps
crampycramstercrancranach
cranach, lucascranachancranagecranapple
cranberriescranberrycranberry bushcranberry culture
cranberry heathcranberry juicecranberry morphemecranberry sauce
cranberry treecranberryingcranberrylikecrance
cranchcrandallitecranecrane fly
crane's billcrane's-billcrane, ichabodcrane, walter
crane-drivercranedcraneflycranelike
cranescranesbillcrangcrangon
crangonidaecranhamcraniacranial
cranial cavitycranial fontanellescranial fossa, ante…cranial fossa, midd…
cranial fossa, post…cranial indexcranial irradiationcranial nerve
cranial nerve disea…cranial nerve injur…cranial nerve neopl…cranial nerves
cranial orbitcranial sinusescranial suturescranially
craniatacraniatecranidiumcraniectomy
craningcraniocaudalcraniocerebral trau…cranioclasm
cranioclastcraniodentalcraniofacialcraniofacial abnorm…
craniofacial abnorm…craniofacial dysost…craniofaciallycraniognomy
craniologicalcraniologicallycraniologistcraniology
craniomandibularcraniomandibular di…craniometercraniometric
craniometric pointcraniometricalcraniometrycraniopagus
craniopharyngiomacraniosacralcranioscopistcranioscopy
craniosophiccraniosynostosescraniosynostosiscraniota
craniotomycranite systemscraniumcraniums
crankcrank anglecrank angle degreecrank call
crank handlecrank lettercrank outcrank science
crank upcrankbirdcrankcasecranked
crankilycrankinesscranklecrankness
crankpincrankscranksetcrankshaft
crankycranmercranmer, thomascrannied
cranniescrannockcrannogcrannoge
crannycrannyingcranstoncrant
crantaracrantscrapcrap artist
crap gamecrap on a stickcrap ones pantscrap out
crap shootingcrap upcrap-shootercrapaud
crapaud, jeancrapaudinecrapecrape fern
crape jasminecrape myrtlecrapedcrapefish
crapehangercrapelikecrapettecrapface
crapfestcrapfloodcrapgamecraphat
crapheadcrapholecraphousecraping
craploadcrapmobilecrapnelcrapola
crappercrappiecrappilycrappiness
crappitycrapplecrappletcrappo
crappycrapscrapshootcrapshooter
crapstormcraptacularcraptasticcraptastical
craptexcrapulacrapulecrapulence
crapulentcrapulentallcrapulouscrapulously
crapulousnesscrapwarecrapycraquelure
crarecrascrasecrash
crash and burncrash barriercrash boxcrash cart
crash coursecrash cymbalcrash dietcrash dive
crash gearboxcrash helmetcrash hotcrash land
crash landingcrash locator beaconcrash outcrash pad
crash position indi…crash programcrash programmecrash rescue and fi…
crash spacecrash testcrash test dummycrash trolley
crash-divecrash-helmetcrash-landcrashable
crashawcrashaw, richardcrashdumpcrashed
crashercrashingcrashinglycrashless
crashlikecrashlyticscrashpadcrashproof
crashworthinesscrashworthycrashycrasis
craspediacraspedotacraspedotecrass
crassamentcrassamentumcrassimentcrassitude
crasslycrassnesscrassostreacrassula
crassula ovatacrassulaceaecrassulaceancrassus
crassus, lucius lic…crassus, marcus lic…crastinationcrat
crataeguscrataegus aestivaliscrataegus apiifoliacrataegus biltmorea…
crataegus calpodend…crataegus coccineacrataegus coccinea …crataegus crus-galli
crataegus laevigatacrataegus marshalliicrataegus molliscrataegus monogyna
crataegus oxyacanthacrataegus oxycanthacrataegus pedicella…crataegus tomentosa
cratchcratecratedcrateful
crateloadcratercrater facecrater lake
crater lake nationa…crater moundcrateredcrateriform
cratering chargecraterlesscraterletcraterlike
craterostigmacraterouscraters of the mooncrates
cratevacratingcratinuscratippus
cratippus of athenscratolagniacratoncratonic
craturcraturelesscratyluscraugastor augusti
craunchcraunchedcraunchingcravat
cravattedcravecravedcraven
cravenedcravenettecraveningcravenly
cravennesscravercravingcravingness
crawcrawdadcrawdaddycrawdaddy!
crawfishcrawfish outcrawfordcrawford and balcar…
crawford, marioncrawford, thomascrawforditecrawk
crawlcrawl incrawl spacecrawl with
crawlablecrawledcrawlercrawley
crawlingcrawling back to youcrawling horrorcrawlspace
crawlycraxcraycraye
crayercrayer, caspar decrayettecrayfish
crayfishercrayfishermancrayfisherycrayola
crayoncrayonedcrayoningcrayonlike
craythurcrayturcrazecraze-mill
crazedcrazedlycrazednesscrazily
crazinesscrazingcrazing-millcrazy
crazy bitchcrazy bonecrazy eightscrazy eyes
crazy gluecrazy golfcrazy horsecrazy house
crazy like a foxcrazy pavingcrazy quiltcrazy weed
crazy-asscrazyweedcrccrc handbook
crécreablecreacionismocreaght
creakcreakedcreakilycreakiness
creakingcreakinglycreakle, mr.creaky
creamcream cakecream cheesecream corn
cream crackercream crackeredcream in ones jeanscream laid
cream of tartarcream of the cropcream of wheatcream off
cream piecream pitchercream puffcream sauce
cream sodacream teacream upcream violet
cream-coloredcream-colored cours…cream-facedcream-fruit
cream-of-tartar treecream-slicecream-whitecreamcake
creamcupscreamedcreamed corncreamer
creameriescreamerycreamilycreaminess
creamingcreamlesscreamlikecreampie
creamsiclecreamwarecreamycreance
creantcreasecrease-resistantcreased
creaselesscreaseproofcreasercreaseyite
creashakcreasingcreasotecreasy
creasy, sir edwardcreatcreatablecreate
create (dc)create by mental actcreate from raw mat…create from raw stu…
create mentallycreate verballycreate, read, updat…created
created bycreatescreaticcreatin
creatinecreatine kinasecreatine kinase, bb…creatine kinase, mb…
creatine kinase, mi…creatine kinase, mm…creatine phosphatecreatine phosphoric…
creatingcreating by mental …creating by removalcreating from raw m…
creating one fleshcreatinincreatininasecreatinine
creationcreation sciencecreationalcreationarily
creationarycreationismcreationistcreationistic
creativasc medicalcreativecreative accountingcreative activity
creative alliescreative artists ag…creative brain stud…creative circle adv…
creative citizencreative commonscreative commons li…creative destruction
creative differencescreative energycreative personcreative skillset
creative thinkercreative thinkingcreative workcreative writing
creativelivecreativelycreativenesscreativity
creatorcreatorlesscreatorlikecreators
creatorshipcreatresscreatrixcreatural
creaturecreature comfortcreature comfortscreature feature
creaturedomcreaturelesscreaturelikecreatureliness
creaturelycreaturescreatures of habitcreatureship
creaturizecreazecrebcreb-binding protein
crébilloncrebricostatecrebrisulcatecrebritude
crebrouscrechecrécycred
credalcredant technologiescredencecredence table
credendacredendumcredentcredential
credentialedcredentialingcredentialismcredentialization
credentialscredenzacrederitycredibility
credibility gapcrediblecrediblenesscredibly
creditcredit accountcrédit agricole co…credit analyst
credit applicationcredit bureaucredit cardcredit card fraud
credit card tartcredit crunchcredit default opti…credit default swap
credit entrycredit eventcrédit fonciercredit hour
credit limitcredit linecredit mobiliercredit note
credit ordercredit ratingcredit referencecredit report
credit riskcredit scorecredit score in the…credit sesame
credit sidecredit systemcredit transfercredit union
credit-deposit ratiocreditabilitycreditablecreditableness
creditablycreditedcreditingcreditless
créditocreditorcreditor's rightscreditors rights
creditresscreditrixcreditscreditworthiness
creditworthycredneritecredocredobaptist
credophilecredoraxcredulitivenesscredulity
credulouscredulouslycredulousnesscree
creech, kentuckycreech, williamcreedcreedal
creeditecreedlesscreedmorecreek
creek bedcreek confederacycreekfishcreekfront
creekologycreekscreeksidecreekwater
creekycreelcreelercreem
creepcreep feedcreep increep into
creep jointcreep someone outcreep upcreep up on
creepagecreepercreepethcreephole
creepiecreepifycreepilycreepiness
creepingcreeping barragecreeping bellflowercreeping bent
creeping bentgrasscreeping buglecreeping buttercupcreeping charlie
creeping crowfootcreeping elegancecreeping featurismcreeping featuritis
creeping ferncreeping jennycreeping junipercreeping lily
creeping minecreeping oxaliscreeping snowberrycreeping soft grass
creeping spike rushcreeping st john's …creeping thistlecreeping thyme
creeping willowcreeping windmill g…creeping wintergreencreeping wood sorrel
creeping zinniacreepinglycreeplecreepmeter
creepscreepycreepy-crawliescreepy-crawly
creepy-peepycreescreesecrefting
creighton, mandellcremacremaillerecremains
cremastercremastericcrematecremation
cremation chambercremationistcrematorcrematorial
crematoriescrematoriumcrematoriumscrematory
cremecreme anglaiscreme bruleecreme caramel
creme de cacaocreme de fraisecreme de menthecrème fraîche
crémieuxcremo, west virginiacremocarpcremona
cremorcremornecremosincrems
cremulatorcrenarchaealcrenarchaeoncrenarchaeota
crenarchaeotalcrenarchaeotecrenatecrenate leaf
crenatedcrenationcrenaturecrenel
crenelatecrenelatedcrenelated moldingcrenelating
crenelationcrenellatecrenellatedcrenellated moulding
crenellationcrenellecrenelledcrengle
crenic acidcrenklecrenotherapycrenshaw
crenulatecrenulatedcrenulationcreo
creodontcreolecreole statecreole-fish
creoleancreoliancreolincreolization
creolizecreoncreopointcreosol
creosotecreosote bushcreosotedcreosotelike
creosotingcrepcrepancecrepane
crepecrepe de chinecrepe ferncrepe flower
crepe gardeniacrepe jasminecrepe marocaincrepe myrtle
crepe papercrepe rubbercrepe suzettecrepelike
creperiecrepeycrepidomacrepis
crepitantcrepitatecrepitatedcrepitating
crepitationcrepitation ralecrepitouscrepitus
creponcreptcrepusclecrepuscular
crepuscular raycrepuscularitycrepuscularlycrepuscule
crepusculinecrepusculouscrepusculumcrerarite
crescrescencecrescendocrescendo bioscience
crescentcrescent citycrescent mooncrescent roll
crescent unmanned s…crescent-cell anaem…crescent-cell anemiacrescent-shaped
crescentiacrescentia cujetecrescenticcrescentini
crescentiuscrescentwisecrescivecresco
crescographcresolcresolatecresorcin
crespellecrespi, giuseppecrespinecrespo
cresscress greencress plantcresselle
cressescressetcressidacresslike
cressoncressycrestcrest cloud
crest syndromecrestatechcrestedcrested cariama
crested coral rootcrested larkcrested mynacrested penguin
crested screamercrested swiftcrested titcrested wheat grass
crested wheatgrasscrestfallencrestiecresting
crestlesscrestless wavecrestmontcrestone telecom
creswellcreswell, sir cresw…creswick, thomascresyl
cresyliccreta, oklahomacretaceancretaceous
cretaceous periodcretaceouslycretaciouscretan
cretan dittanycretecrete dittanycretian
creticcreticismcretincretinise
cretinismcretinizecretinoidcretinous
cretismcretonnecretorcretose
creusacreusecreusot, lecreutzer
creutzfeldt-jakob d…creutzfeldt-jakob s…creutzfeldt–jakob…creux
creuzercrevallecrevalle jackcrevant
crevassecrèvecœurcrevetcrevice
crevice corrosioncrevicedcreviscrew
crew chiefcrew cutcrew membercrew neck
crew necklinecrew sockcrew-served weaponcrewcut
crewecrewedcrewelcrewelwork
crewercrewetcrewlesscrewman
crewmatecrewmembercrewneckcrewnecked
crexcrex crexcrfscrg
cri de coeurcri de coeur*cri du chat syndromecri technologies
cri-du-chat syndromecriacribcrib board
crib deathcrib mattresscrib notecrib sheet
crib-bitercrib-bitingcribbagecribbage board
cribbedcribbercribbingcribble
cribbledcribblingcribellumcriber
criblikecribratecribrationcribriform
cribriform platecribrosecribrouscric
cricetidcricetidaecricetinaecricetulus
cricetuscricetus cricetuscrichtoncrichton, james
crichtonitecricifycrickcricket
cricket ballcricket batcricket equipmentcricket field
cricket frogcricket groundcricket matchcricket pitch
cricket whitescricket-bat willowcricketercricketing
cricketlesscricketscricketycricoid
cricoid cartilagecricondenthermcricothyroidcricothyroidotomy
criddleitecriedcrieffcrier
criescriestcrigancrigler-najjar synd…
crigler–najjar sy…crikeycrilecrillon
crimcrimblecrimbocrime
crime against human…crime against naturecrime analysiscrime and punishment
crime fictioncrime lordcrime of passioncrime prevention
crime ratecrime scenecrime statisticscrime syndicate
crime victimscrime wavecrime-riddencrimea
crimea-congo hemorr…crimeancrimean peninsulacrimean tatar
crimean warcrimebustercrimebustingcrimefighter
crimefightingcrimefreecrimefulcrimeless
crimelikecrimereportscrimeriddencrimes
crimes against huma…crimethinc.crimethinkcrimeware
crimewatch uscrimewavecrimidinecriminal
criminal activitycriminal congresscriminal contemptcriminal conversati…
criminal courtcriminal intelligen…criminal intentcriminal investigat…
criminal justicecriminal lawcriminal negligencecriminal offence
criminal possessioncriminal procedurecriminal prosecutioncriminal psychologi…
criminal psychologycriminal recordcriminal suitcriminalisation
criminalisecriminalismcriminalistcriminalistics
criminalitycriminalizationcriminalizecriminally
criminalnesscriminaloidcriminalscriminate
criminatedcriminatingcriminationcriminative
criminatorycriminicriminogenicallycriminol.
criminologicalcriminologistcriminologycriminous
criminousnesscriminycrimosincrimp
crimpagecrimpedcrimpercrimping
crimplecrimpledcrimplingcrimpness
crimpycrimsoncrimson clovercrimson glory
crimson hexagoncrimson informaticscrimsonedcrimsoning
crimsonlycrimsonnesscrinalcrinan canal
crinatedcrinatorycrincumcrincum-crancum
crinedcrinelcrinetcringe
cringelingcringemakingcringercringeworthy
cringingcringinglycringingnesscringle
cringycriniculturalcrinierecrinigerous
crinioncrinitalcrinitecrinitory
criniviruscrinklecrinkle rootcrinkle-root
crinkledcrinklerootcrinklinesscrinkling
crinklycrinkycrinoidcrinoidal
crinoideacrinoideancrinolinecrinolined
crinosecrinositycrinumcriobolium
criollocriollo peoplecriosphinxcrioulo
cripcripescripplecripple creek
crippledcrippled insidecripplenesscrippler
cripplewarecripplingcripplinglycripply
cripscriptcriscocrises
crisiscrisis action plann…crisis centercrisis intervention
crisis managementcrisis negotiationcrisis-riddencrisp
crisp breadcrispatecrispatedcrispation
crispaturecrispbreadcrispedcrispen
crispercrisphead lettucecrispi, francescocrispily
crispincrispin and crispin…crispinesscrisping
crisplycrispnesscrispscrispus
crispus attucks: a …crispycrispy gamercrispy!
criss crosscriss-crosscriss-cross applesa…crissa
crissalcrisscrosscrisscross heartcrisscross-row
crisscrossedcrissumcristcrista
cristalcristalinacristallocristallology
cristatecristiano ronaldocristinacristo redentor
cristobalcristobal balenciagacristóbal carbinecristobal colon
cristobalitecristoforo colombocritcrit.
critchfieldcriteriacriterialcriterion
criterionalcriterionlesscriterionscriterior
criteriumcrithcrithidiacrithidia fascicula…
crithomancucrithomancycritiascritic
criticalcritical acclaimcritical analysiscritical angle
critical appraisalcritical assetcritical asset listcritical capability
critical carecritical conditioncritical control po…critical diagnostics
critical discourse …critical functioncritical illnesscritical information
critical infrastruc…critical infrastruc…critical inquirycritical intelligen…
critical itemcritical item listcritical joint duty…critical literacy
critical masscritical mediacritical micelle co…critical occupation…
critical opalescencecritical pathcritical path methodcritical pathways
critical periodcritical period (ps…critical pointcritical practice
critical rationalismcritical requirementcritical reviewcritical reynolds n…
critical sectioncritical speedcritical supplies a…critical sustainabi…
critical technologi…critical theorycritical thinkingcritical tide level
critical updatecritical valuecritical vulnerabil…criticality
criticality assessm…criticallycritically acclaimedcriticalmetrics
criticalnesscriticastercriticisablecriticise
criticisedcriticisercriticisingcriticism
criticisms of globa…criticizablecriticizationcriticize
criticizercriticizinglycriticocriticproof
criticscritiquecritique^itcrititech
critoncrittercritter sittercrittercism
critterscriuscrix labscrixivan
crizzelcrizzlecrizzledcrk-associated subs…
crlfcrm softwarecrna goracrnged
crocroûtecro-magnoncro-quette
croaghcroakcroakedcroaker
croakingcroakycroatcroatia
croatiancroatian peasant pa…croatian sheepdogcroato-serbian
croatscroa`tia and slavon…croccrocacin
crocanthemum canade…crocecroceincroceous
crocethiacrocethia albacrocetincroche
crochetcrochet hookcrochet needlecrochet stitch
crochetedcrochetercrochetingcrochetwork
crochucrociarycrocidolitecrocin
crockcrock of goldcrock of shitcrock pot
crock upcrockedcrockercrockers
crockerycrocketcrocketedcrocketing
crockettcrockett, samuel ru…crockingcrockpot
crockycrocodilecrocodile birdcrocodile clip
crocodile rivercrocodile tearcrocodile tearscrocodilelike
crocodilescrocodiliacrocodiliancrocodilian reptile
crocodilitycrocodiluscrocodoccrocodylia
crocodylidaecrocodyliformcrocodylomorphcrocodylus
crocodylus niloticuscrocodylus porosuscrocoisitecrocoite
crocolitecroconatecroconazolecroconic
croconic acidcrocosecrocosmiacrocotta
crocscrocuscrocus sativuscrocus technology
crocuslikecrocutacrocuta crocutacroesus
croftcroftercroftingcroftland
crohncrohn diseasecrohn's diseasecrohns disease
croirecroiscroisadecroisado
croisecroissantcroissantecroissantlike
crois\u00e9croix de guerrecrokercroker, john wilson
croker, t. croftoncroll, jamescroly, georgecrom
cromacromagnoncromakalimcromar
cromartycromecrome, johncromlech
cromniomancycromoglicatecromoglicic acidcromoglycate
cromolyncromolyn sodiumcromornacromorne
cromptoncrompton urban dist…crompton, samuelcromulent
cromwellcromwell (oliver)cromwell, olivercromwell, richard
cromwell, thomascromwelliancronartiumcronartium ribicola
cronecronelcronelikecronenbergian
cronetcroniancroniescronk
cronocronotecronstadtcronstedtite
crontabcronuscronusitecrony
cronyismcronyisticcroo monkeycroodle
crookcrook and nannycrookackcrookback
crookbackedcrookbillcrookedcrooked-stemmed ast…
crookedlycrookednesscrookencrookery
crookescrookes radiometercrookes tubecrookes, william
crookesitecrookingcrookneckcrookneck squash
crookscrooncroonedcrooner
crooningcroonycropcrop circle
crop failurecrop outcrop residuecrop rotation
crop topcrop upcrop venturescrop-dusting
crop-earcrop-earedcrop-tailedcropbound
cropdustercropecropfulcropland
croplandscroplikecroppablecropped
croppercroppingcrops, agriculturalcropsick
cropupcroque-madamecroque-monsieurcroquembouche
croquetcroquet ballcroquet equipmentcroquet mallet
croquetacroquetedcroquetingcroquetlike
croquettecroquiscrorecrorepati
crosbycroscarmellosecrosiercrosiered
crosletcrosnecrospovidonecross
cross a bridge befo…cross batcross bitcross bun
cross channelcross checkcross circulationcross compiler
cross connectioncross countrycross cover versioncross crosslet
cross dressingcross examinationcross examinecross fell
cross firecross florycross haircross hairs
cross infectioncross junctioncross matchingcross merchandising
cross multiplycross of calvarycross of goldcross of gold speech
cross of lorrainecross offcross one's eyescross one's fingers
cross ones armscross ones fingerscross ones heartcross oneself
cross outcross overcross pathscross patt\u00e9e
cross peen hammercross pixel mediacross postcross product
cross protectioncross purposecross purposescross question
cross reactionscross referencecross roadscross sea
cross sectioncross someones palmcross someones pathcross street
cross swordscross tabcross tabulationcross talk
cross tellcross that bridge w…cross the aislecross the floor
cross the linecross the rubiconcross thwartcross vine
cross windcross wirecross, mrs.cross, southern
cross, victoriacross-cross-actioncross-armed
cross-bandedcross-bearercross-beddingcross-bench
cross-benchercross-birthcross-bordercross-bred
cross-breedcross-breedingcross-browsercross-bun
cross-capcross-channelcross-checkcross-classification
cross-compatiblecross-connecting bo…cross-console emula…cross-contaminate
cross-contaminationcross-correlationcross-countrycross-country jumpi…
cross-country ridingcross-country skiingcross-cousincross-crosslet
cross-culturalcross-cultural comp…cross-cuttingcross-days
cross-divisioncross-dockingcross-dresscross-dresser
cross-dressingcross-examinationcross-examinecross-examined
cross-examinercross-examiningcross-eyecross-eyed
cross-fertilecross-fertilisationcross-fertilisecross-fertilization
cross-fertilizecross-filecross-firecross-foster
cross-fosteringcross-garnetcross-grainedcross-index
cross-infectioncross-jack yardcross-lagcross-leaved heath
cross-leggedcross-levelingcross-lightcross-linguistic
cross-linguisticallycross-linkcross-linkagecross-linked
cross-linking reage…cross-loading (pers…cross-magnetizing e…cross-modal
cross-multiplicationcross-multiplycross-over blockcross-over studies
cross-partycross-patchcross-pawlcross-phrasing
cross-platformcross-plycross-pollinatecross-pollinating
cross-pollinationcross-primingcross-purposecross-question
cross-questionedcross-questionercross-questioningcross-ratio
cross-reactcross-reactioncross-reactivitycross-reading
cross-refercross-referencecross-resistancecross-section
cross-sectionalcross-sectional stu…cross-sellcross-selling
cross-sententialcross-servicingcross-shapedcross-spale
cross-spallcross-springercross-staffcross-stitch
cross-stitchercross-stonecross-tabcross-tail
cross-targeting (nu…cross-tiecross-tiningcross-tolerance
cross-towncross-traincross-trainingcross-trees
cross-validationcross-vaultingcross-weekcrossband
crossbandingcrossbarcrossbarredcrossbeak
crossbeamcrossbeam systemscrossbenchcrossbencher
crossbenchescrossbillcrossbitecrossbody
crossbonescrossborderscrossbowcrossbow technologi…
crossbowercrossbowmancrossbracingcrossbred
crossbreedcrossbreedercrossbreedingcrossbuck
crosscheckcrosschxcrossclaimcrossclass
crosscorrelationcrosscoupledcrosscouplingcrosscourt
crosscurrentcrosscutcrosscut sawcrosscutting
crossecrosse, andrewcrossectionalcrossed
crossed eyecrossed fingerscrossed loop sensorcrossed out
crossercrossettecrosseyedcrossfade
crossfadercrossfeedcrossfibercrossfield
crossfirecrossfirst bankcrossfishcrossflow
crossgendercrossgradecrossgrainedcrossguard
crosshaircrosshairscrosshatchcrosshatched
crosshatchingcrossheadcrossheadingcrossing
crossing areacrossing automationcrossing guardcrossing number
crossing overcrossing over, gene…crossing the linecrossing wires
crossingscrossjackcrossleggedcrosslet
crosslicensecrosslightcrosslikecrosslinear
crosslinearlycrosslinguisticcrosslinkcrosslinker
crossloadcrossloopcrosslotscrossly
crossmatchcrossmatchedcrossmembercrossmetathesis
crossnathcrossnationalcrossnesscrossopterygian
crossopterygiicrossovercrossover dribblecrossover health ma…
crossover votecrossover votercrossoverscrosspatch
crosspiececrosspipecrossplaycrossplayer
crosspointcrosspostcrosspostercrossraguel
crossrangecrossreactcrossreactioncrossreactive
crossrefcrossroadcrossroadscrossroads systems
crossrowcrossruffcrosstabcrosstalk
crosstiecrosstowncrosstreecrosstrees
crosstxcrosswalkcrosswaycrossways
crossways, dorsetcrosswindcrosswisecrossword
crossword (puzzle)crossword puzzlecrosswordlikecrossworld warranty
crosswortcrostatacrostinicrotal
crotalariacrotalaria sagitall…crotalaria spectabi…crotalid venoms
crotalidaecrotalinecrotalocrotalum
crotaluscrotalus adamanteuscrotalus atroxcrotalus cerastes
crotalus horridus a…crotalus horridus h…crotalus lepiduscrotalus mitchellii
crotalus scutulatuscrotalus tigriscrotalus viridiscrotamiton
crotanaldehydecrotaphioncrotaphitecrotaphitic
crotaphytuscrotchcrotch fruitcrotch hair
crotch rocketcrotch, williamcrotchedcrotches
crotchetcrotchet restcrotchetedcrotchetiness
crotchetycrotchlesscrotoncroton bug
croton eluteriacroton oilcroton tigliumcrotona
crotonaldehydecrotonamidecrotonatecrotonates
crotonbugcrotonecrotoniccrotonic acid
crotonic acidscrotoninecrotonylenecrotophaga
crotoxincrottalcrottlecrottles
crotylcrotylationcrotylborationcrouch
crouch downcrouchedcrouchercrouching
croudcroukecroupcroupade
croupalcroupecroupercroupier
croupier's rakecroupierecroupinesscroupous
croupycrousecroustadecrout
croutoncrouzon syndromecrowcrow blackbird
crow corncrow garliccrow pheasantcrow point
crow scarercrow stepcrow's feetcrow's foot
crow's nestcrow's-feetcrow's-footcrow's-nest
crow-baitcrow-quillcrow-silkcrow-trodden
crowbaitcrowbarcrowbar hotelcrowberry
crowberry familycrowdcrowd artcrowd catch
crowd controlcrowd intocrowd outcrowd play
crowd sciencecrowd supplycrowd surfercrowd surfing
crowd technologiescrowd togethercrowd upcrowd-poisoning
crowdboostercrowdcastcrowdcompasscrowdcomputing syst…
crowdedcrowdengineeringcrowdercrowders
crowdfeedcrowdflikcrowdflowercrowdfunder
crowdfundingcrowdgathercrowdhallcrowdie
crowdingcrowdlikecrowdlycrowdmed
crowdmobcrowdopticcrowdpleasercrowdrise
crowdscrowdslingcrowdsourcecrowdsourced
crowdsourcingcrowdspringcrowdstarcrowdstrike
crowdtapcrowdtiltcrowdtwistcrowdvance
crowdycrowdzonecrowdzucrowe, eyre evans
crowe, sir james ar…croweatercrowedcrowflower
crowfootcrowfoot familycrowfoot grasscrowing
crowkeepercrowleycrowleyancrowlike
crowncrown attorneycrown beardcrown bioscience
crown cactuscrown colonycrown compoundscrown court
crown daisycrown estatecrown ethercrown ethers
crown firecrown flowercrown gallcrown glass
crown graftingcrown greencrown green bowlscrown imperial
crown in towncrown jewelcrown jewelscrown land
crown lengtheningcrown lenscrown mammalcrown molding
crown monkeycrown of thornscrown officecrown point
crown princecrown princesscrown roastcrown saw
crown sidecrown vetchcrown viccrown ward
crown wartcrown wheelcrown-beardcrown-imperial
crown-of-the-fieldcrown-postcrown-rump lengthcrown-saw
crownbeardcrowne, johncrownedcrowned crane
crowned headcrowned pigeoncrownedstcrowner
crownetcrowningcrownlesscrownlet
crownlikecrownpeakcrownpiececrowns
crownworkcrowscrows feetcrows foot
crows nestcrowstepcrowstonecrowth
crowther, samuel ad…crowtoecroycroydon
croydon faceliftcroylstonecroyncroys
crozecroze ironcroziercroziered
crpcrs reprocessing se…crtcrt screen
crtscrucrubeenscruces
cruces, cubacrucialcrucialitycrucially
cruciancrucian carpcruciatecruciate sulcus
cruciationcruciblecrucible steelcrucible, electric
crucifercruciferaecruciferouscruciferous plant
cruciferous vegetab…crucifiedcrucifiercrucifix
crucifix fishcrucifixescrucifixioncrucifixionlike
crucifixlikecruciformcrucifycrucifying
crucigerouscruciverbalismcruciverbalistcruck
crudcruddinesscruddlecruddy
crudecrude oilcrude sapcrude-oil
crudelycruden, alexandercrudenesscrudités
cruditiescruditycrudlecrudos
crudwarecrudycruelcruel and unusual p…
cruel plantcruella de vilcruellycruelness
cruelscrueltiescrueltycruentaren
cruentatecruentouscruetcruet-stand
cruftcruft togethercruftscruftsmanship
cruftycruikshankcruikshank, georgecruis
cruisecruise controlcruise linecruise liner
cruise missilecruise shipcruisedcruiselike
cruisercruiserweightcruisewearcruisewise
cruisingcruising altitudecruising levelcruisy
cruivecrullcrullercrum
crumbcrumb cakecrumb downcrumbcloth
crumbedcrumbercrumbilycrumbiness
crumbingcrumblablecrumblecrumbled
crumblercrumblesscrumbletcrumblike
crumblinesscrumblingcrumblinglycrumblings
crumblycrumbscrumbumcrumby
crumcakecrumenalcrumhorncrummable
crummilycrumminesscrummockcrummy
crumpcrumpetcrumpinesscrumple
crumple zonecrumpledcrumplednesscrumpler
crumplingcrumplycrumpycrunch
crunch numberscrunch timecrunchablecrunched
crunchercrunchinesscrunchingcrunchingly
crunchycrunchyrollcrunkcrunkle
crunodalcrunodecruorcruorin
crupcruppercruracrural
crurophiliacrurotarsalcruscrusade
crusadedcrusadercrusaderlikecrusaders
crusadescrusades, thecrusadingcrusado
crusecruse, illinoiscrusetcrush
crush hatcrush oncrush on youcrush out
crush partycrush roomcrush syndromecrushable
crushblvdcrushedcrushed leathercrushed rock
crushed sugarcrusheecrushercrusher gauge
crushingcrushinglycrushpathcrushproof
crusoe, robinsoncrustcrustacrustacea
crustaceancrustacean larvaecrustaceologicalcrustaceologist
crustaceologycrustaceouscrustaceousnesscrustal
crustal movementcrustal platecrustalogicalcrustalogist
crustalogycrustatedcrustationcrusted
crustiecrustiescrustificcrustily
crustinesscrustingcrustlesscrustlike
crustosecrustose thalluscrustquakecrusty
crutcrutchcrutchedcrutches
crutchlikecruthcruttercrux
crux australiscrux biomedicalcrux gammatacrux of the matter
crux simplexcruxescruyff turncruz records
cruzacruzadocruzadoscruzan
cruzeirocrwthcrycry all the way to …
cry blue murdercry downcry forcry for help
cry havoccry in ones beercry like a babycry like a little g…
cry me a rivercry offcry ones eyes outcry out
cry out againstcry out forcry someone a rivercry the blues
cry unclecry uncle!cry wolfcry-baby
cry-baby treecryaesthesiacryalcrybaby
crybaby treecryercryesthesiacryin'
cryingcrying birdcrying callcrying shame
cryo-cryo-electron micro…cryo-transmissioncryo-transmission e…
cryoablationcryoactivationcryoanaesthesiacryoanesthesia
cryobenchcryobiologicalcryobiologistcryobiology
cryobiosiscryobioticcryobuffercryocardioplegia
cryocauterycryochreptcryocondensationcryoconite
cryocooledcryocoolercryocoolingcryocrystallography
cryodetectorcryoelectroncryoelectron micros…cryoelectroncs
cryoelectroniccryoelectronicscryofixationcryofixed
cryofocuscryofocusingcryogencryogenesis
cryogeniancryogeniccryogenic liquidcryogenically
cryogenicscryogeninecryogenycryoglobulin
cryoglobulinemiacryoglobulinscryohydratecryohydric
cryokinesiscryolathecryolitecryolithionite
cryoliticcryomagneticcryometercryometric
cryometrycryomicrographcryomicroscopiccryomicroscopy
cryomodulecryoniccryonicscryopathy
cryopelagiccryophiliccryophobiacryophorus
cryophysicscryophytecryoplanktoncryoport
cryoprecipitatecryopreservationcryopreservecryopreserved
cryopreservingcryoprobecryoprotectcryoprotected
cryoprotectioncryoprotective agen…cryopumpcryopyrin
cryopyrin-associate…cryoregimecryosamplingcryoscope
cryoscopiccryoscopycryosectioncryosectioned
cryosectioningcryosleepcryosolventcryosphere
cryosphericcryostasiscryostatcryostatic
cryosurgeoncryosurgerycryosurgicalcryosurgically
cryotechnologycryotemperaturecryotherapistcryotherapy
cryotomographiccryotomographycryotrapcryotrapping
cryotroncryoturbationcryoultramicrotomycryovial
cryovolcaniccryovolcanismcryovolcanocryoxtract instrume…
cryppiecrypsiscryptcryptacanthodes
cryptacanthodes mac…cryptalcryptanalysiscryptanalyst
cryptanalyticcryptanalyticscryptandcryptarithm
cryptatecrypticcryptic colorationcryptic crossword
crypticalcrypticallycrypticitycryptid
cryptidinecryptlikecryptocrypto-
crypto-fascismcrypto-fascistcrypto-fascisticcrypto-revisionism
cryptobiontcryptobiosiscryptobioticcryptobranchiata
cryptobranchiatecryptobranchidaecryptobranchuscryptobranchus alle…
cryptocaryacryptocercidaecryptocercuscryptochannel
cryptochiralcryptochiralitycryptochromecryptochromes
cryptococcalcryptococcosiscryptococcuscryptococcus gattii
cryptococcus neofor…cryptocorynecryptocracycryptocrystalline
cryptodepressioncryptoexoticcryptogamcryptogame
cryptogamiacryptogamiaecryptogamiancryptogamic
cryptogamistcryptogamouscryptogeniccryptogenic organiz…
cryptogenic speciescryptogramcryptogrammacryptogramma acrost…
cryptogramma crispacryptogrammataceaecryptogrammaticcryptogrammatically
cryptogramscryptographcryptographalcryptographer
cryptographiccryptographic infor…cryptographicalcryptographically
cryptographistcryptographycryptohalitecryptolalia
cryptolectcryptolepiscryptologiccryptological
cryptologistcryptologycryptomariacryptomaterial
cryptomelanecryptomeriacryptomeria japonicacryptomnesia
cryptomodulecryptomonadcryptomorphiccryptomorphism
cryptoncryptonephridialcryptonymcryptonymic
cryptopartcryptophanecryptophonecryptophthalmos
cryptophyceaecryptophytacryptophytecryptopine
cryptoporticuscryptoprocessingcryptoprocessorcryptoprocta
cryptoprocta feroxcryptorchidcryptorchidismcryptorchidy
cryptorchismcryptosporacryptosporidiidaecryptosporidiosis
cryptosporidiumcryptosporidium par…cryptosystemcryptotermes
cryptotermes breviscryptotiscryptotis parvacryptotomography
cryptoxanthincryptozoologicalcryptozoologistcryptozoology
crypturicrystalcrystal ballcrystal clear
crystal countercrystal detectorcrystal gazingcrystal healing
crystal iscrystal latticecrystal methcrystal microphone
crystal momentumcrystal oscillatorcrystal pickupcrystal pleat
crystal radiocrystal rectifiercrystal setcrystal structure
crystal teacrystal twinningcrystal violetcrystal-clear
crystalgenomicscrystalisationcrystalisecrystalised
crystalizecrystalizedcrystalliferouscrystallin
crystallinecrystalline fructosecrystalline humourcrystalline lens
crystallinitycrystallinscrystallisationcrystallise
crystallisedcrystallitecrystallizabilitycrystallizable
crystallizationcrystallization, el…crystallizecrystallized
crystallized fruitcrystallized gingercrystallizercrystallizing
crystallo-crystalloclastcrystallogenesiscrystallogenic
crystallogenicalcrystallogenycrystallogeometricalcrystallographer
crystallographiccrystallographicalcrystallographicallycrystallography
crystallography, x-…crystalloidcrystallomancycrystallometry
crystallophonecrystallurgycrystalluriacrystalplex
cry_wolfcr\u00e8checr\u00e8me anglaisecr\u00e8me br\u00fb…
cr\u00e8me caramelcr\u00e8me de cacaocr\u00e8me de cassiscr\u00e8me de la cr…
cr\u00e8me de menthecr\u00e8me fra\u00e…cr\u00e9maill\u00e8…cr\u00eape de chine
cr\u00eape papercr\u00eape suzettecr\u00eapy 

The Web's Largest Resource for

Definitions & Translations


A Member Of The STANDS4 Network