Found 3,160 definitions starting with CR:

crcrêpesuzettecrèchecrème
crèmedecacaocrèmedecassiscrèmedelacr&…crèmedementhe
crèmefra&ici…crèvecoeurcr.cr/che
crabcrab applecrab boilcrab burger
crab cactuscrab canoncrab cocktailcrab grass
crab legscrab louiscrab lousecrab mentality
crab nebulacrab rangooncrab spidercrab tree
crab-eatercrab-eating dogcrab-eating foxcrab-eating macaque
crab-eating opossumcrab-eating raccooncrab-eating sealcrab-plover
crab-yawscrabapplecrabapple jellycrabbe, george
crabbedcrabbedlycrabbednesscrabber
crabbilycrabbinesscrabbingcrabbish
crabbitcrabburgercrabbycrabby person
crabeatercrabeater sealcrabercrabfaced
crabgrasscrabletcrablikecrabmeat
crabronidcrabscrabsidlecrabstick
crabwisecrac!crachecracid
cracidaecrackcrack a bookcrack a crib
crack a fatcrack a smilecrack a smile... an…crack addict
crack babycrack cocainecrack downcrack down (on)
crack down oncrack ficcrack housecrack of dawn
crack of doomcrack oncrack ones fingerscrack onto
crack pipecrack rockcrack rootcrack seed
crack shotcrack throughcrack traincrack up
crack whorecrack willowcrack wisecrack-brained
crack-pipecrack-upcrackacrackable
crackbackcrackberrycrackbraincrackbrained
crackdowncrackedcracked tooth syndr…cracked wheat
cracked-wheat breadcrackednesscrackercracker bonbon
cracker boxcracker crumbscracker jackcracker jacks
cracker-barrelcrackerberrycrackerboxcrackerjack
crackerlesscrackerlikecrackerscrackhead
crackhousecrackingcracking upcrackle
crackle chinacrackle – the bes…crackleberrycrackled
cracklescracklewarecracklikecrackling
cracklinglycracklingscracklinscrackly
cracknelcrackowcrackpipecrackpot
crackpotterycrackproofcrackscracksman
cracksmencracktivismcracktrocrackup
crackwhorecrackycracky wagoncracovian
cracoviennecracowcracowescracticidae
cracticinaecracticuscradd signaling ada…cradgedness
cradlecradle capcradle catholiccradle mountain
cradle of civilizat…cradle robbercradle snatchercradle technologies
cradle-to-cradle de…cradle-to-gravecradleboardcradled
cradlelikecradlesongcradlingcraft
craft centrecraft faircraft unioncrafted
craftednesscraftercraftilycraftiness
craftlesscraftlikecrafts centrecraftsman
craftsmanlikecraftsmanlycraftsmanshipcraftsmaster
craftsmencraftspersoncraftspersonshipcraftswoman
craftswomanshipcraftsycraftworkcraftworker
craftycragcragfastcragged
craggednesscraggercraggilycragginess
craggycragscragsmancragsmen
craiccraiecraigcraig flounder
craig serani marshcraig ventnercraig, johncraig, sir thomas
craigenputtockcraigiecraigslistcraigslist inc.
craigslistercraigslistingcraikcraik, george little
craik, mrs.crailcraincraiova
craisincrakecrakeberrycraker
crakowcramcram downcram full
cram schoolcram sessioncram worldwidecram-full
crambecrambe maritimacrambe plantcrambe sponge
crambocrambucramdowncramer
cramer, johann bapt…cramlingtoncrammedcrammer
crammingcramoisiecramoisycramp
cramp ironcramp someones stylecrampbarkcramped
crampednesscrampetcrampfishcrampiness
crampingcrampitcramponcramponee
cramponscrampooncrampoonscramps
crampycramstercrancranach
cranach, lucascranachancranagecranapple
cranberriescranberrycranberry bushcranberry culture
cranberry heathcranberry juicecranberry morphemecranberry sauce
cranberry treecranberryingcranberrylikecrance
cranchcrandallitecranecrane fly
crane's billcrane's-billcrane, ichabodcrane, walter
crane-drivercranedcraneflycranelike
cranescranesbillcrangcrangon
crangonidaecranhamcraniacranial
cranial cavitycranial fontanellescranial fossa, ante…cranial fossa, midd…
cranial fossa, post…cranial indexcranial irradiationcranial nerve
cranial nerve disea…cranial nerve injur…cranial nerve neopl…cranial nerves
cranial orbitcranial sinusescranial suturescranially
craniatacraniatecranidiumcraniectomy
craningcraniocaudalcraniocerebral trau…cranioclasm
cranioclastcraniodentalcraniofacialcraniofacial abnorm…
craniofacial abnorm…craniofacial dysost…craniofaciallycraniognomy
craniologicalcraniologicallycraniologistcraniology
craniomandibularcraniomandibular di…craniometercraniometric
craniometric pointcraniometricalcraniometrycraniopagus
craniopharyngiomacraniosacralcranioscopistcranioscopy
craniosophiccraniosynostosescraniosynostosiscraniota
craniotomycranite systemscraniumcraniums
crankcrank anglecrank angle degreecrank call
crank handlecrank lettercrank outcrank science
crank upcrankbirdcrankcasecranked
crankilycrankinesscranklecrankness
crankpincrankscranksetcrankshaft
crankycranmercranmer, thomascrannied
cranniescrannockcrannogcrannoge
crannycrannyingcranstoncrant
crantaracrantscrapcrap artist
crap gamecrap on a stickcrap ones pantscrap out
crap shootingcrap upcrap-shootercrapaud
crapaud, jeancrapaudinecrapecrape fern
crape jasminecrape myrtlecrapedcrapefish
crapehangercrapelikecrapettecrapface
crapfestcrapfloodcrapgamecraphat
crapheadcrapholecraphousecraping
craploadcrapmobilecrapnelcrapola
crappercrappiecrappilycrappiness
crappitycrapplecrappletcrappo
crappycrapscrapshootcrapshooter
crapstormcraptacularcraptasticcraptastical
craptexcrapulacrapulecrapulence
crapulentcrapulentallcrapulouscrapulously
crapulousnesscrapwarecrapycraquelure
crarecrascrasecrash
crash and burncrash barriercrash boxcrash cart
crash coursecrash cymbalcrash dietcrash dive
crash gearboxcrash helmetcrash hotcrash land
crash landingcrash locator beaconcrash outcrash pad
crash position indi…crash programcrash programmecrash rescue and fi…
crash spacecrash testcrash test dummycrash trolley
crash-divecrash-helmetcrash-landcrashable
crashawcrashaw, richardcrashdumpcrashed
crashercrashingcrashinglycrashless
crashlikecrashlyticscrashpadcrashproof
crashworthinesscrashworthycrashycrasis
craspediacraspedotacraspedotecrass
crassamentcrassamentumcrassimentcrassitude
crasslycrassnesscrassostreacrassula
crassula ovatacrassulaceaecrassulaceancrassus
crassus, lucius lic…crassus, marcus lic…crastinationcrat
crataeguscrataegus aestivaliscrataegus apiifoliacrataegus biltmorea…
crataegus calpodend…crataegus coccineacrataegus coccinea …crataegus crus-galli
crataegus laevigatacrataegus marshalliicrataegus molliscrataegus monogyna
crataegus oxyacanthacrataegus oxycanthacrataegus pedicella…crataegus tomentosa
cratchcratecratedcrateful
crateloadcratercrater facecrater lake
crater lake nationa…crater moundcrateredcrateriform
cratering chargecraterlesscraterletcraterlike
craterostigmacraterouscraters of the mooncrates
cratevacratingcratinuscratippus
cratippus of athenscratolagniacratologycraton
cratoniccraturcraturelesscratylus
craugastor augusticraunchcraunchedcraunching
cravatcravattedcravecraved
cravencravenedcravenettecravening
cravenlycravennesscravercraving
cravingnesscrawcrawdadcrawdaddy
crawdaddy!crawfishcrawfish outcrawford
crawford and balcar…crawford, marioncrawford, thomascrawfordite
crawkcrawlcrawl incrawl space
crawl withcrawlablecrawledcrawler
crawlerwaycrawleycrawlingcrawling back to you
crawling horrorcrawlspacecrawlycrax
craycrayecrayercrayer, caspar de
crayettecrayfishcrayfishercrayfisherman
crayfisherycrayolacrayoncrayoned
crayoningcrayonlikecraythurcraytur
crazecraze-millcrazedcrazedly
crazednesscrazilycrazinesscrazing
crazing-millcrazycrazy bitchcrazy bone
crazy eightscrazy eyescrazy gluecrazy golf
crazy horsecrazy housecrazy like a foxcrazy paving
crazy quiltcrazy weedcrazy-asscrazyweed
crccrc handbookcrécreable
creacionismocreaghtcreakcreaked
creakilycreakinesscreakingcreakingly
creakle, mr.creakycreamcream cake
cream cheesecream corncream crackercream crackered
cream in ones jeanscream laidcream of tartarcream of the crop
cream of wheatcream offcream piecream pitcher
cream puffcream saucecream sodacream tea
cream upcream violetcream-coloredcream-colored cours…
cream-facedcream-fruitcream-of-tartar treecream-slice
cream-whitecreamcakecreamcupscreamed
creamed corncreamercreameriescreamery
creamilycreaminesscreamingcreamless
creamlikecreampiecreamsiclecreamware
creamycreancecreantcrease
crease-resistantcreasedcreaselesscreaseproof
creasercreaseyitecreashakcreasing
creasotecreasycreasy, sir edwardcreat
creatablecreatecreate (dc)create by mental act
create from raw mat…create from raw stu…create mentallycreate verbally
create, read, updat…createdcreated bycreates
creaticcreatincreatinecreatine kinase
creatine kinase, bb…creatine kinase, mb…creatine kinase, mi…creatine kinase, mm…
creatine phosphatecreatine phosphoric…creatingcreating by mental …
creating by removalcreating from raw m…creating one fleshcreatinin
creatininasecreatininecreationcreation science
creationalcreationarilycreationarycreationism
creationistcreationisticcreativasc medicalcreative
creative accountingcreative activitycreative alliescreative artists ag…
creative brain stud…creative circle adv…creative citizencreative commons
creative commons li…creative destructioncreative differencescreative energy
creative personcreative skillsetcreative thinkercreative thinking
creative workcreative writingcreativelivecreatively
creativenesscreativitycreatorcreatorless
creatorlikecreatorscreatorshipcreatress
creatrixcreaturalcreaturecreature comfort
creature comfortscreature featurecreaturedomcreatureless
creaturelikecreaturelinesscreaturelycreatures
creatures of habitcreatureshipcreaturizecreaze
crebcreb-binding proteincrébilloncrebricostate
crebrisulcatecrebritudecrebrouscreche
crécycredcredalcredant technologies
credencecredence tablecredendacredendum
credentcredentialcredentialedcredentialing
credentialismcredentializationcredentialscredenza
crederitycredibilitycredibility gapcredible
crediblenesscrediblycreditcredit account
crédit agricole co…credit analystcredit applicationcredit bureau
credit cardcredit card fraudcredit card tartcredit crunch
credit default opti…credit default swapcredit entrycredit event
crédit fonciercredit historycredit hourcredit limit
credit linecredit mobiliercredit notecredit order
credit ratingcredit referencecredit reportcredit risk
credit scorecredit score in the…credit sesamecredit side
credit systemcredit transfercredit unioncredit-deposit ratio
creditabilitycreditablecreditablenesscreditably
creditedcreditingcreditlesscrédito
creditorcreditor's rightscreditors rightscreditress
creditrixcreditscreditworthinesscreditworthy
credneritecredocredobaptistcredophile
credoraxcredulitivenesscredulitycredulous
credulouslycredulousnesscreecreech, kentucky
creech, williamcreedcreedalcreedite
creedlesscreedmorecreekcreek bed
creek confederacycreekfishcreekfrontcreekology
creekscreeksidecreekwatercreeky
creelcreelercreemcreep
creep feedcreep increep intocreep joint
creep someone outcreep upcreep up oncreepage
creepercreepethcreepholecreepie
creepifycreepilycreepinesscreeping
creeping barragecreeping bellflowercreeping bentcreeping bentgrass
creeping buglecreeping buttercupcreeping charliecreeping crowfoot
creeping elegancecreeping featurismcreeping featuritiscreeping fern
creeping jennycreeping junipercreeping lilycreeping mine
creeping oxaliscreeping snowberrycreeping soft grasscreeping spike rush
creeping st john's …creeping thistlecreeping thymecreeping willow
creeping windmill g…creeping wintergreencreeping wood sorrelcreeping zinnia
creepinglycreeplecreepmetercreeps
creepycreepy-crawliescreepy-crawlycreepy-peepy
creescreesecreftingcreighton, mandell
cremacremaillerecremainscremaster
cremastericcrematecremationcremation chamber
cremationistcrematorcrematorialcrematories
crematoriumcrematoriumscrematorycreme
creme anglaiscreme bruleecreme caramelcreme de cacao
creme de fraisecreme de menthecrème fraîchecrémieux
cremo, west virginiacremocarpcremonacremor
cremornecremosincremscremulator
crenarchaealcrenarchaeoncrenarchaeotacrenarchaeotal
crenarchaeotecrenatecrenate leafcrenated
crenationcrenaturecrenelcrenelate
crenelatedcrenelated moldingcrenelatingcrenelation
crenellatecrenellatedcrenellated mouldingcrenellation
crenellecrenelledcrenglecrenic acid
crenklecrenotherapycrenshawcrenulate
crenulatedcrenulationcreocreodont
creolecreole statecreole-fishcreolean
creoliancreolincreolizationcreolize
creoncreopointcreosolcreosote
creosote bushcreosotedcreosotelikecreosoting
crepcrepancecrepanecrepe
crepe de chinecrepe ferncrepe flowercrepe gardenia
crepe jasminecrepe marocaincrepe myrtlecrepe paper
crepe rubbercrepe suzettecrepelikecreperie
crepeycrepidomacrepiscrepitant
crepitatecrepitatedcrepitatingcrepitation
crepitation ralecrepitouscrepituscrepon
creptcrepusclecrepuscularcrepuscular ray
crepuscularitycrepuscularlycrepusculecrepusculine
crepusculouscrepusculumcrépy, aisnecrerarite
crescrescencecrescendocrescendo bioscience
crescentcrescent citycrescent mooncrescent roll
crescent unmanned s…crescent-cell anaem…crescent-cell anemiacrescent-shaped
crescentiacrescentia cujetecrescenticcrescentini
crescentiuscrescentwisecrescivecresco
crescographcresolcresolatecresorcin
crespellecrespi, giuseppecrespinecrespo
cresscress greencress plantcresselle
cressescressetcressidacresslike
cressoncressycrestcrest cloud
crest syndromecrestatechcrestedcrested cariama
crested coral rootcrested larkcrested mynacrested penguin
crested screamercrested swiftcrested titcrested wheat grass
crested wheatgrasscrestfallencrestiecresting
crestlesscrestless wavecrestmontcrestone telecom
creswellcreswell, sir cresw…creswick, thomascresyl
cresyliccreta, oklahomacretaceancretaceous
cretaceous periodcretaceouslycretaciouscretan
cretan dittanycretecrete dittanycretian
creticcreticismcretincretinise
cretinismcretinizecretinoidcretinous
cretismcretonnecretorcretose
creusacreusecreusot, lecreutzer
creutzfeldt-jakob d…creutzfeldt-jakob s…creutzfeldt–jakob…creux
creuzercrevallecrevalle jackcrevant
crevassecrèvecœurcrevetcrevice
crevice corrosioncrevicedcreviscrew
crew chiefcrew cutcrew membercrew neck
crew necklinecrew sockcrew-served weaponcrewcut
crewecrewedcrewelcrewelwork
crewercrewetcrewlesscrewman
crewmatecrewmembercrewneckcrewnecked
crexcrex crexcrfscrg
cri de coeurcri de coeur*cri du chat syndromecri technologies
cri-du-chat syndromecriacribcrib board
crib deathcrib mattresscrib notecrib sheet
crib-bitercrib-bitingcribbagecribbage board
cribbedcribbercribbingcribble
cribbledcribblingcribellumcriber
criblikecribratecribrationcribriform
cribriform platecribrosecribrouscric
cricetidcricetidaecricetinaecricetulus
cricetuscricetus cricetuscrichtoncrichton, james
crichtonitecricifycrickcricket
cricket ballcricket batcricket equipmentcricket field
cricket frogcricket groundcricket matchcricket pitch
cricket whitescricket-bat willowcricketercricketing
cricketlesscricketscricketycricoid
cricoid cartilagecricondenthermcricothyroidcricothyroidotomy
criddleitecriedcrieffcrier
criescriestcrigancrigler-najjar synd…
crigler–najjar sy…crikeycrilecrillon
crimcrimblecrimbocrime
crime against human…crime against naturecrime analysiscrime and punishment
crime fictioncrime lordcrime of passioncrime prevention
crime ratecrime scenecrime statisticscrime syndicate
crime victimscrime wavecrime-riddencrimea
crimea-congo hemorr…crimeancrimean peninsulacrimean tatar
crimean warcrimebustercrimebustingcrimefighter
crimefightingcrimefreecrimefulcrimeless
crimelikecrimereportscrimeriddencrimes
crimes against huma…crimethinc.crimethinkcrimeware
crimewatch uscrimewavecrimidinecriminal
criminal activitycriminal citationcriminal congresscriminal contempt
criminal conversati…criminal courtcriminal intelligen…criminal intent
criminal investigat…criminal justicecriminal lawcriminal negligence
criminal offencecriminal possessioncriminal procedurecriminal prosecution
criminal psychologi…criminal psychologycriminal recordcriminal suit
criminalisationcriminalisecriminalismcriminalist
criminalisticscriminalitycriminalizationcriminalize
criminallycriminalnesscriminaloidcriminals
criminatecriminatedcriminatingcrimination
criminativecriminatorycriminicriminogenically
criminol.criminologicalcriminologistcriminology
criminouscriminousnesscriminycrimosin
crimpcrimpagecrimpedcrimper
crimpingcrimplecrimpledcrimpling
crimpnesscrimpycrimsoncrimson clover
crimson glorycrimson hexagoncrimson informaticscrimsoned
crimsoningcrimsonlycrimsonnesscrinal
crinan canalcrinatedcrinatorycrincum
crincum-crancumcrinedcrinelcrinet
cringecringelingcringemakingcringer
cringeworthycringingcringinglycringingness
cringlecringycriniculturalcriniere
crinigerouscrinioncrinitalcrinite
crinitorycriniviruscrinklecrinkle root
crinkle-rootcrinkledcrinklerootcrinkliness
crinklingcrinklycrinkycrinoid
crinoidalcrinoideacrinoideancrinoline
crinolinedcrinosecrinositycrinum
crioboliumcriollocriollo peoplecriosphinx
crioulocripcripescripple
cripple creekcrippledcrippled insidecrippleness
cripplercripplewarecripplingcripplingly
cripplycripscriptcrisco
crisescrisiscrisis action plann…crisis center
crisis interventioncrisis managementcrisis negotiationcrisis-ridden
crispcrisp breadcrispatecrispated
crispationcrispaturecrispbreadcrisped
crispencrispercrisphead lettucecrispi, francesco
crispilycrispincrispin and crispin…crispiness
crispingcrisplycrispnesscrisps
crispuscrispus attucks: a …crispycrispy gamer
crispy!criss crosscriss-crosscriss-cross applesa…
crissacrissalcrisscrosscrisscross heart
crisscross-rowcrisscrossedcrissumcrist
cristacristalcristalinacristallo
cristallologycristatecristiano ronaldocristina
cristo redentorcristobalcristobal balenciagacristóbal carbine
cristobal coloncristobalitecristoforo colombocrit
crit.critchfieldcriteriacriterial
criterioncriterionalcriterionlesscriterions
criteriorcriteriumcrithcrithidia
crithidia fascicula…crithomancucrithomancycritias
criticcriticalcritical acclaimcritical analysis
critical anglecritical appraisalcritical assetcritical asset list
critical capabilitycritical carecritical conditioncritical control po…
critical diagnosticscritical discourse …critical functioncritical illness
critical informationcritical infrastruc…critical infrastruc…critical inquiry
critical intelligen…critical itemcritical item listcritical joint duty…
critical literacycritical masscritical mediacritical micelle co…
critical occupation…critical opalescencecritical pathcritical path method
critical pathwayscritical periodcritical period (ps…critical point
critical practicecritical rationalismcritical requirementcritical review
critical reynolds n…critical sectioncritical speedcritical supplies a…
critical sustainabi…critical technologi…critical theorycritical thinking
critical tide levelcritical updatecritical valuecritical vulnerabil…
criticalitycriticality assessm…criticallycritically acclaimed
criticalmetricscriticalnesscriticastercriticisable
criticisecriticisedcriticisercriticising
criticismcriticisms of globa…criticizablecriticization
criticizecriticizercriticizinglycritico
criticproofcriticscritiquecritique^it
crititechcritoncrittercritter sitter
crittercismcritterscriuscrix labs
crixivancrizzelcrizzlecrizzled
crk-associated subs…crlfcrm softwarecrna gora
crngedcrocroûtecro-magnon
cro-quettecroaghcroakcroaked
croakercroakingcroakycroat
croatiacroatiancroatian peasant pa…croatian sheepdog
croato-serbiancroatscroa`tia and slavon…croc
crocacincrocanthemum canade…crocecrocein
croceouscrocethiacrocethia albacrocetin
crochecrochetcrochet hookcrochet needle
crochet stitchcrochetedcrochetercrocheting
crochetworkcrochucrociarycrocidolite
crocincrockcrock of goldcrock of shit
crock potcrock upcrockedcrocker
crockerscrockerycrocketcrocketed
crocketingcrockettcrockett, samuel ru…crocking
crockpotcrockycrocodilecrocodile bird
crocodile clipcrocodile rivercrocodile tearcrocodile tears
crocodilelikecrocodilescrocodiliacrocodilian
crocodilian reptilecrocodilitycrocodiluscrocodoc
crocodyliacrocodylidaecrocodyliformcrocodylomorph
crocodyluscrocodylus niloticuscrocodylus porosuscrocoisite
crocoitecrocolitecroconatecroconazole
croconiccroconic acidcrocosecrocosmia
crocottacrocscrocuscrocus sativus
crocus technologycrocuslikecrocutacrocuta crocuta
croesuscroftcroftercrofting
croftlandcrohncrohn diseasecrohn's disease
crohns diseasecroirecroiscroisade
croisadocroisecroissantcroissante
croissantlikecrois\u00e9croix de guerrecroker
croker, john wilsoncroker, t. croftoncroll, jamescroly, george
cromcromacromagnoncromakalim
cromarcromartycromecrome, john
cromlechcromniomancycromoglicatecromoglicic acid
cromoglycatecromolyncromolyn sodiumcromorna
cromornecromptoncrompton urban dist…crompton, samuel
cromulentcromwellcromwell (oliver)cromwell, oliver
cromwell, richardcromwell, thomascromwelliancronartium
cronartium ribicolacronecronelcronelike
cronenbergiancronetcroniancronies
cronkcronocronotecronstadt
cronstedtitecrontabcronuscronusite
cronycronyismcronyisticcroo monkey
croodlecrookcrook and nannycrookack
crookbackcrookbackedcrookbillcrooked
crooked-stemmed ast…crookedlycrookednesscrooken
crookerycrookescrookes radiometercrookes tube
crookes, williamcrookesitecrookingcrookneck
crookneck squashcrookscrooncrooned
croonercrooningcroonycrop
crop circlecrop failurecrop outcrop residue
crop rotationcrop topcrop upcrop ventures
crop-dustingcrop-earcrop-earedcrop-tailed
cropboundcropdustercropecropful
croplandcroplandscroplikecroppable
croppedcroppercroppingcrops, agricultural
cropsickcropupcroque-madamecroque-monsieur
croquembouchecroquetcroquet ballcroquet equipment
croquet malletcroquetacroquetedcroqueting
croquetlikecroquettecroquiscrore
crorepaticrosbycroscarmellosecrosier
crosieredcrosletcrosnecrospovidone
crosscross a bridge befo…cross batcross bit
cross buncross channelcross checkcross circulation
cross compilercross connectioncross countrycross cover version
cross crossletcross dressingcross examinationcross examine
cross fellcross firecross florycross hair
cross hairscross infectioncross junctioncross matching
cross merchandisingcross multiplycross of calvarycross of gold
cross of gold speechcross of lorrainecross offcross one's eyes
cross one's fingerscross ones armscross ones fingerscross ones heart
cross oneselfcross outcross overcross paths
cross patt\u00e9ecross peen hammercross pixel mediacross post
cross productcross protectioncross purposecross purposes
cross questioncross reactionscross referencecross roads
cross seacross sectioncross someones palmcross someones path
cross streetcross swordscross tabcross tabulation
cross talkcross tellcross that bridge w…cross the aisle
cross the floorcross the linecross the rubiconcross thwart
cross vinecross windcross wirecross, mrs.
cross, southerncross, victoriacross-cross-action
cross-armedcross-bandedcross-bearercross-bedding
cross-benchcross-benchercross-birthcross-border
cross-bredcross-breedcross-breedingcross-browser
cross-buncross-capcross-channelcross-check
cross-classificationcross-compatiblecross-connecting bo…cross-console emula…
cross-contaminatecross-contaminationcross-correlationcross-country
cross-country jumpi…cross-country ridingcross-country skiingcross-cousin
cross-crossletcross-culturalcross-cultural comp…cross-cutting
cross-dayscross-divisioncross-dockingcross-dress
cross-dressercross-dressingcross-examinationcross-examine
cross-examinedcross-examinercross-examiningcross-eye
cross-eyedcross-fertilecross-fertilisationcross-fertilise
cross-fertilizationcross-fertilizecross-filecross-fire
cross-fostercross-fosteringcross-garnetcross-grained
cross-indexcross-infectioncross-jack yardcross-lag
cross-leaved heathcross-leggedcross-levelingcross-light
cross-linguisticcross-linguisticallycross-linkcross-linkage
cross-linkedcross-linking reage…cross-loading (pers…cross-magnetizing e…
cross-modalcross-multiplicationcross-multiplycross-over block
cross-over studiescross-partycross-patchcross-pawl
cross-phrasingcross-platformcross-plycross-pollinate
cross-pollinatingcross-pollinationcross-primingcross-purpose
cross-questioncross-questionedcross-questionercross-questioning
cross-ratiocross-reactcross-reactioncross-reactivity
cross-readingcross-refercross-referencecross-resistance
cross-sectioncross-sectionalcross-sectional stu…cross-sell
cross-sellingcross-sententialcross-servicingcross-shaped
cross-spalecross-spallcross-springercross-staff
cross-stitchcross-stitchercross-stonecross-tab
cross-tailcross-targeting (nu…cross-tiecross-tining
cross-tolerancecross-towncross-traincross-training
cross-treescross-validationcross-vaultingcross-week
crossbandcrossbandingcrossbarcrossbarred
crossbeakcrossbeamcrossbeam systemscrossbench
crossbenchercrossbenchescrossbillcrossbite
crossbodycrossbonescrossborderscrossbow
crossbow technologi…crossbowercrossbowmancrossbracing
crossbredcrossbreedcrossbreedercrossbreeding
crossbuckcrosscheckcrosschxcrossclaim
crossclasscrosscorrelationcrosscoupledcrosscoupling
crosscourtcrosscurrentcrosscutcrosscut saw
crosscuttingcrossecrosse, andrewcrossectional
crossedcrossed eyecrossed fingerscrossed loop sensor
crossed outcrossercrossettecrosseyed
crossfadecrossfadercrossfeedcrossfiber
crossfieldcrossfirecrossfirst bankcrossfish
crossflowcrossgendercrossgradecrossgrained
crossguardcrosshaircrosshairscrosshatch
crosshatchedcrosshatchingcrossheadcrossheading
crossingcrossing areacrossing automationcrossing guard
crossing numbercrossing overcrossing over, gene…crossing the line
crossing wirescrossingscrossjackcrosslegged
crossletcrosslicensecrosslightcrosslike
crosslinearcrosslinearlycrosslinguisticcrosslink
crosslinkercrossloadcrossloopcrosslots
crosslycrossmatchcrossmatchedcrossmember
crossmetathesiscrossnathcrossnationalcrossness
crossopterygiancrossopterygiicrossovercrossover dribble
crossover health ma…crossover votecrossover votercrossovers
crosspatchcrosspiececrosspipecrossplay
crossplayercrosspointcrosspostcrossposter
crossraguelcrossrangecrossreactcrossreaction
crossreactivecrossrefcrossroadcrossroads
crossroads systemscrossrowcrossruffcrosstab
crosstalkcrosstiecrosstowncrosstree
crosstreescrosstxcrosswalkcrossway
crosswayscrossways, dorsetcrosswindcrosswise
crosswordcrossword (puzzle)crossword puzzlecrosswordlike
crossworld warrantycrosswortcrostatacrostini
crotalcrotalariacrotalaria sagitall…crotalaria spectabi…
crotalid venomscrotalidaecrotalinecrotalo
crotalumcrotaluscrotalus adamanteuscrotalus atrox
crotalus cerastescrotalus horridus a…crotalus horridus h…crotalus lepidus
crotalus mitchelliicrotalus scutulatuscrotalus tigriscrotalus viridis
crotamitoncrotanaldehydecrotaphioncrotaphite
crotaphiticcrotaphytuscrotchcrotch fruit
crotch haircrotch rocketcrotch, williamcrotched
crotchescrotchetcrotchet restcrotcheted
crotchetinesscrotchetycrotchlesscroton
croton bugcroton eluteriacroton oilcroton tiglium
crotonacrotonaldehydecrotonamidecrotonate
crotonatescrotonbugcrotonecrotonic
crotonic acidcrotonic acidscrotoninecrotonylene
crotophagacrotoxincrottalcrottle
crottlescrotylcrotylationcrotylboration
crouchcrouch downcrouchedcroucher
crouchingcroudcroukecroup
croupadecroupalcroupecrouper
croupiercroupier's rakecroupierecroupiness
croupouscroupycrousecroustade
croutcroutoncrouzon syndromecrow
crow blackbirdcrow corncrow garliccrow pheasant
crow pointcrow scarercrow stepcrow's feet
crow's footcrow's nestcrow's-feetcrow's-foot
crow's-nestcrow-baitcrow-quillcrow-silk
crow-troddencrowbaitcrowbarcrowbar hotel
crowberrycrowberry familycrowdcrowd art
crowd catchcrowd controlcrowd intocrowd out
crowd playcrowd sciencecrowd supplycrowd surfer
crowd surfingcrowd technologiescrowd togethercrowd up
crowd-poisoningcrowdboostercrowdcastcrowdcompass
crowdcomputing syst…crowdedcrowdengineeringcrowder
crowderscrowdfeedcrowdflikcrowdflower
crowdfundercrowdfundingcrowdgathercrowdhall
crowdiecrowdingcrowdlikecrowdly
crowdmedcrowdmobcrowdopticcrowdpleaser
crowdrisecrowdscrowdslingcrowdsource
crowdsourcedcrowdsourcingcrowdspringcrowdstar
crowdstrikecrowdtapcrowdtiltcrowdtwist
crowdvancecrowdycrowdzonecrowdzu
crowe, eyre evanscrowe, sir james ar…croweatercrowed
crowflowercrowfootcrowfoot familycrowfoot grass
crowingcrowkeepercrowleycrowleyan
crowlikecrowncrown attorneycrown beard
crown biosciencecrown cactuscrown colonycrown compounds
crown courtcrown daisycrown estatecrown ether
crown etherscrown firecrown flowercrown gall
crown glasscrown graftingcrown greencrown green bowls
crown imperialcrown in towncrown jewelcrown jewels
crown landcrown lengtheningcrown lenscrown mammal
crown moldingcrown monkeycrown of thornscrown office
crown pointcrown princecrown princesscrown roast
crown sawcrown sidecrown vetchcrown vic
crown wardcrown wartcrown wheelcrown-beard
crown-imperialcrown-of-the-fieldcrown-postcrown-rump length
crown-sawcrownbeardcrowne, johncrowned
crowned cranecrowned headcrowned pigeoncrownedst
crownercrownetcrowningcrownless
crownletcrownlikecrownpeakcrownpiece
crownscrownworkcrowscrows feet
crows footcrows nestcrowstepcrowstone
crowthcrowther, samuel ad…crowtoecroy
croydoncroydon faceliftcroylstonecroyn
croyscrozecroze ironcrozier
crozieredcrpcrs reprocessing se…crt
crt screencrtscrucrubeens
crucescruces, cubacrucialcruciality
cruciallycruciancrucian carpcruciate
cruciate sulcuscruciationcruciblecrucible steel
crucible, electriccrucifercruciferaecruciferous
cruciferous plantcruciferous vegetab…crucifiedcrucifier
crucifixcrucifix fishcrucifixescrucifixion
crucifixionlikecrucifixlikecruciformcrucify
crucifyingcrucigerouscruciverbalismcruciverbalist
cruckcrudcruddinesscruddle
cruddycrudecrude oilcrude sap
crude-oilcrudelycruden, alexandercrudeness
cruditéscruditiescruditycrudle
crudoscrudwarecrudycruel
cruel and unusual p…cruel plantcruella de vilcruelly
cruelnesscruelscrueltiescruelty
cruentarencruentatecruentouscruet
cruet-standcruftcruft togethercrufts
cruftsmanshipcruftycruikshankcruikshank, george
cruiscruisecruise controlcruise line
cruise linercruise missilecruise shipcruised
cruiselikecruisercruiserweightcruisewear
cruisewisecruisingcruising altitudecruising level
cruisycruivecrullcruller
crumcrumbcrumb cakecrumb down
crumbclothcrumbedcrumbercrumbily
crumbinesscrumbingcrumblablecrumble
crumbledcrumblercrumblesscrumblet
crumblikecrumblinesscrumblingcrumblingly
crumblingscrumblycrumbscrumbum
crumbycrumcakecrumenalcrumhorn
crummablecrummilycrumminesscrummock
crummycrumpcrumpetcrumpiness
crumplecrumple zonecrumpledcrumpledness
crumplercrumplingcrumplycrumpy
crunchcrunch numberscrunch timecrunchable
crunchedcrunchercrunchinesscrunching
crunchinglycrunchycrunchyrollcrunk
crunklecrunodalcrunodecruor
cruorincrupcruppercrura
cruralcrurophiliacrurotarsalcrus
crusadecrusadedcrusadercrusaderlike
crusaderscrusadescrusades, thecrusading
crusadocrusecruse, illinoiscruset
crushcrush hatcrush oncrush on you
crush outcrush partycrush roomcrush syndrome
crushablecrushblvdcrushedcrushed leather
crushed rockcrushed sugarcrusheecrusher
crusher gaugecrushingcrushinglycrushpath
crushproofcrusoe, robinsoncrustcrusta
crustaceacrustaceancrustacean larvaecrustaceological
crustaceologistcrustaceologycrustaceouscrustaceousness
crustalcrustal movementcrustal platecrustalogical
crustalogistcrustalogycrustatedcrustation
crustedcrustiecrustiescrustific
crustilycrustinesscrustingcrustless
crustlikecrustosecrustose thalluscrustquake
crustycrutcrutchcrutched
crutchescrutchlikecruthcrutter
cruxcrux australiscrux biomedicalcrux gammata
crux of the mattercrux simplexcruxescruyff turn
cruz recordscruzacruzadocruzados
cruzancruzeirocrwthcry
cry all the way to …cry blue murdercry downcry for
cry for helpcry havoccry in ones beercry like a baby
cry like a little g…cry me a rivercry offcry ones eyes out
cry outcry out againstcry out forcry someone a river
cry the bluescry unclecry uncle!cry wolf
cry-babycry-baby treecryaesthesiacryal
crybabycrybaby treecryercryesthesia
cryin'cryingcrying birdcrying call
crying shamecryo-cryo-electron micro…cryo-transmission
cryo-transmission e…cryoablationcryoactivationcryoanaesthesia
cryoanesthesiacryobenchcryobiologicalcryobiologist
cryobiologycryobiosiscryobioticcryobuffer
cryocardioplegiacryocauterycryochreptcryocondensation
cryoconitecryocooledcryocoolercryocooling
cryocrystallographycryodetectorcryoelectroncryoelectron micros…
cryoelectroncscryoelectroniccryoelectronicscryofixation
cryofixedcryofocuscryofocusingcryogen
cryogenesiscryogeniancryogeniccryogenic liquid
cryogenicallycryogenicscryogeninecryogeny
cryoglobulincryoglobulinemiacryoglobulinscryohydrate
cryohydriccryokinesiscryolathecryolite
cryolithionitecryoliticcryomagneticcryometer
cryometriccryometrycryomicrographcryomicroscopic
cryomicroscopycryomodulecryoniccryonics
cryopathycryopelagiccryophiliccryophobia
cryophoruscryophysicscryophytecryoplankton
cryoportcryoprecipitatecryopreservationcryopreserve
cryopreservedcryopreservingcryoprobecryoprotect
cryoprotectedcryoprotectioncryoprotective agen…cryopump
cryopyrincryopyrin-associate…cryoregimecryosampling
cryoscopecryoscopiccryoscopycryosection
cryosectionedcryosectioningcryosleepcryosolvent
cryospherecryosphericcryostasiscryostat
cryostaticcryosurgeoncryosurgerycryosurgical
cryosurgicallycryotechnologycryotemperaturecryotherapist
cryotherapycryotomographiccryotomographycryotrap
cryotrappingcryotroncryoturbationcryoultramicrotomy
cryovialcryovolcaniccryovolcanismcryovolcano
cryoxtract instrume…cryppiecrypsiscrypt
cryptacanthodescryptacanthodes mac…cryptalcryptanalysis
cryptanalystcryptanalyticcryptanalyticscryptand
cryptarithmcryptatecrypticcryptic coloration
cryptic crosswordcrypticalcrypticallycrypticity
cryptidcryptidinecryptlikecrypto
crypto-crypto-fascismcrypto-fascistcrypto-fascistic
crypto-revisionismcryptobiontcryptobiosiscryptobiotic
cryptobranchiatacryptobranchiatecryptobranchidaecryptobranchus
cryptobranchus alle…cryptocaryacryptocercidaecryptocercus
cryptochannelcryptochiralcryptochiralitycryptochrome
cryptochromescryptococcalcryptococcosiscryptococcus
cryptococcus gattiicryptococcus neofor…cryptocorynecryptocracy
cryptocrystallinecryptodepressioncryptoexoticcryptogam
cryptogamecryptogamiacryptogamiaecryptogamian
cryptogamiccryptogamistcryptogamouscryptogenic
cryptogenic organiz…cryptogenic speciescryptogramcryptogramma
cryptogramma acrost…cryptogramma crispacryptogrammataceaecryptogrammatic
cryptogrammaticallycryptogramscryptographcryptographal
cryptographercryptographiccryptographic infor…cryptographical
cryptographicallycryptographistcryptographycryptohalite
cryptolaliacryptolectcryptolepiscryptologic
cryptologicalcryptologistcryptologycryptomaria
cryptomaterialcryptomelanecryptomeriacryptomeria japonica
cryptomnesiacryptomodulecryptomonadcryptomorphic
cryptomorphismcryptoncryptonephridialcryptonym
cryptonymiccryptopartcryptophanecryptophone
cryptophthalmoscryptophyceaecryptophytacryptophyte
cryptopinecryptoporticuscryptoprocessingcryptoprocessor
cryptoproctacryptoprocta feroxcryptorchidcryptorchidism
cryptorchidycryptorchismcryptosporacryptosporidiidae
cryptosporidiosiscryptosporidiumcryptosporidium par…cryptosystem
cryptotermescryptotermes breviscryptotiscryptotis parva
cryptotomographycryptoxanthincryptozoologicalcryptozoologist
cryptozoologycrypturicrystalcrystal ball
crystal clearcrystal countercrystal detectorcrystal gazing
crystal healingcrystal iscrystal latticecrystal meth
crystal microphonecrystal momentumcrystal oscillatorcrystal pickup
crystal pleatcrystal radiocrystal rectifiercrystal set
crystal structurecrystal teacrystal twinningcrystal violet
crystal-clearcrystalgenomicscrystalisationcrystalise
crystalisedcrystalizecrystalizedcrystalliferous
crystallincrystallinecrystalline fructosecrystalline humour
crystalline lenscrystallinitycrystallinscrystallisation
crystallisecrystallisedcrystallitecrystallizability
crystallizablecrystallizationcrystallization, el…crystallize
crystallizedcrystallized fruitcrystallized gingercrystallizer
crystallizingcrystallo-crystalloclastcrystallogenesis
crystallogeniccrystallogenicalcrystallogenycrystallogeometrical
crystallographercrystallographiccrystallographicalcrystallographically
crystallographycrystallography, x-…crystalloidcrystallomancy
crystallometrycrystallophonecrystallurgycrystalluria
crystalplexcry_wolfcr\u00e8checr\u00e8me anglaise
cr\u00e8me br\u00fb…cr\u00e8me caramelcr\u00e8me de cacaocr\u00e8me de cassis
cr\u00e8me de la cr…cr\u00e8me de menthecr\u00e8me fra\u00e…cr\u00e9maill\u00e8…
cr\u00eape de chinecr\u00eape papercr\u00eape suzettecr\u00eapy

The Web's Largest Resource for

Definitions & Translations


A Member Of The STANDS4 Network