Found 3,132 definitions starting with CR:

crcrêpesuzettecrèchecrème
crèmedecacaocrèmedecassiscrèmedelacr&…crèmedementhe
crèmefra&ici…crèvecoeurcr.cr/che
crabcrab applecrab boilcrab burger
crab cactuscrab canoncrab cocktailcrab grass
crab legscrab louiscrab lousecrab mentality
crab nebulacrab rangooncrab spidercrab tree
crab-eatercrab-eating dogcrab-eating foxcrab-eating macaque
crab-eating opossumcrab-eating raccooncrab-eating sealcrab-plover
crab-yawscrabapplecrabapple jellycrabbe, george
crabbedcrabbedlycrabbednesscrabber
crabbilycrabbinesscrabbingcrabbish
crabbitcrabburgercrabbycrabby person
crabeatercrabeater sealcrabercrabfaced
crabgrasscrabletcrablikecrabmeat
crabronidcrabscrabsidlecrabstick
crabwisecrac!crachecracid
cracidaecrackcrack a bookcrack a crib
crack a fatcrack a smilecrack a smile... an…crack addict
crack babycrack cocainecrack downcrack down (on)
crack down oncrack ficcrack housecrack of dawn
crack of doomcrack oncrack ones fingerscrack onto
crack pipecrack rockcrack rootcrack seed
crack shotcrack throughcrack traincrack up
crack whorecrack willowcrack wisecrack-brained
crack-pipecrack-upcrackacrackable
crackbackcrackberrycrackbraincrackbrained
crackdowncrackedcracked tooth syndr…cracked wheat
cracked-wheat breadcrackednesscrackercracker bonbon
cracker boxcracker crumbscracker jackcracker jacks
cracker-barrelcrackerberrycrackerboxcrackerjack
crackerlesscrackerlikecrackerscrackhead
crackhousecrackingcracking upcrackle
crackle chinacrackle – the bes…crackleberrycrackled
cracklescracklewarecracklikecrackling
cracklinglycracklingscracklinscrackly
cracknelcrackowcrackpipecrackpot
crackpotterycrackproofcrackscracksman
cracksmencracktivismcracktrocrackup
crackwhorecrackycracky wagoncracovian
cracoviennecracowcracowescracticidae
cracticinaecracticuscradd signaling ada…cradgedness
cradlecradle capcradle catholiccradle mountain
cradle of civilizat…cradle robbercradle snatchercradle technologies
cradle-to-cradle de…cradle-to-gravecradleboardcradled
cradlelikecradlesongcradlingcraft
craft centrecraft faircraft unioncrafted
craftednesscraftercraftilycraftiness
craftlesscraftlikecrafts centrecraftsman
craftsmanlikecraftsmanlycraftsmanshipcraftsmaster
craftsmencraftspersoncraftspersonshipcraftswoman
craftswomanshipcraftsycraftworkcraftworker
craftycragcragfastcragged
craggednesscraggercraggilycragginess
craggycragscragsmancragsmen
craiccraiecraigcraig flounder
craig serani marshcraig ventnercraig, johncraig, sir thomas
craigenputtockcraigiecraigslistcraigslist inc.
craigslistercraigslistingcraikcraik, george little
craik, mrs.crailcraincraiova
craisincrakecrakeberrycraker
crakowcramcram downcram full
cram schoolcram sessioncram worldwidecram-full
crambecrambe maritimacrambe plantcrambe sponge
crambocrambucramdowncramer
cramer, johann bapt…cramlingtoncrammedcrammer
crammingcramoisiecramoisycramp
cramp ironcramp someones stylecrampbarkcramped
crampednesscrampetcrampfishcrampiness
crampingcrampitcramponcramponee
cramponscrampooncrampoonscramps
crampycramstercrancranach
cranach, lucascranachancranagecranapple
cranberriescranberrycranberry bushcranberry culture
cranberry heathcranberry juicecranberry morphemecranberry sauce
cranberry treecranberryingcranberrylikecrance
cranchcrandallitecranecrane fly
crane's billcrane's-billcrane, ichabodcrane, walter
crane-drivercranedcraneflycranelike
cranescranesbillcrangcrangon
crangonidaecranhamcraniacranial
cranial cavitycranial fontanellescranial fossa, ante…cranial fossa, midd…
cranial fossa, post…cranial indexcranial irradiationcranial nerve
cranial nerve disea…cranial nerve injur…cranial nerve neopl…cranial nerves
cranial orbitcranial sinusescranial suturescranially
craniatacraniatecranidiumcraniectomy
craningcraniocaudalcraniocerebral trau…cranioclasm
cranioclastcraniodentalcraniofacialcraniofacial abnorm…
craniofacial abnorm…craniofacial dysost…craniofaciallycraniognomy
craniologicalcraniologicallycraniologistcraniology
craniomandibularcraniomandibular di…craniometercraniometric
craniometric pointcraniometricalcraniometrycraniopagus
craniopharyngiomacraniosacralcranioscopistcranioscopy
craniosophiccraniosynostosescraniosynostosiscraniota
craniotomycranite systemscraniumcraniums
crankcrank anglecrank angle degreecrank call
crank handlecrank lettercrank outcrank science
crank upcrankbirdcrankcasecranked
crankilycrankinesscranklecrankness
crankpincrankscranksetcrankshaft
crankycranmercranmer, thomascrannied
cranniescrannockcrannogcrannoge
crannycrannyingcranstoncrant
crantaracrantscrapcrap artist
crap gamecrap on a stickcrap ones pantscrap out
crap shootingcrap upcrap-shootercrapaud
crapaud, jeancrapaudinecrapecrape fern
crape jasminecrape myrtlecrapedcrapefish
crapehangercrapelikecrapettecrapface
crapfestcrapfloodcrapgamecraphat
crapheadcrapholecraphousecraping
craploadcrapmobilecrapnelcrapola
crappercrappiecrappilycrappiness
crappitycrapplecrappletcrappo
crappycrapscrapshootcrapshooter
crapstormcraptacularcraptasticcraptastical
craptexcrapulacrapulecrapulence
crapulentcrapulentallcrapulouscrapulously
crapulousnesscrapwarecrapycraquelure
crarecrascrasecrash
crash and burncrash barriercrash boxcrash cart
crash coursecrash cymbalcrash dietcrash dive
crash gearboxcrash helmetcrash hotcrash land
crash landingcrash locator beaconcrash outcrash pad
crash position indi…crash programcrash programmecrash rescue and fi…
crash spacecrash testcrash test dummycrash trolley
crash-divecrash-helmetcrash-landcrashable
crashawcrashaw, richardcrashdumpcrashed
crashercrashingcrashinglycrashless
crashlikecrashlyticscrashpadcrashproof
crashworthinesscrashworthycrashycrasis
craspediacraspedotacraspedotecrass
crassamentcrassamentumcrassimentcrassitude
crasslycrassnesscrassostreacrassula
crassula ovatacrassulaceaecrassulaceancrassus
crassus, lucius lic…crassus, marcus lic…crastinationcrat
crataeguscrataegus aestivaliscrataegus apiifoliacrataegus biltmorea…
crataegus calpodend…crataegus coccineacrataegus coccinea …crataegus crus-galli
crataegus laevigatacrataegus marshalliicrataegus molliscrataegus monogyna
crataegus oxyacanthacrataegus oxycanthacrataegus pedicella…crataegus tomentosa
cratchcratecratedcrateful
crateloadcratercrater facecrater lake
crater lake nationa…crater moundcrateredcrateriform
cratering chargecraterlesscraterletcraterlike
craterostigmacraterouscraters of the mooncrates
cratevacratingcratinuscratippus
cratippus of athenscratolagniacratoncratonic
craturcraturelesscratyluscraugastor augusti
craunchcraunchedcraunchingcravat
cravattedcravecravedcraven
cravenedcravenettecraveningcravenly
cravennesscravercravingcravingness
crawcrawdadcrawdaddycrawdaddy!
crawfishcrawfish outcrawfordcrawford and balcar…
crawford, marioncrawford, thomascrawforditecrawk
crawlcrawl incrawl spacecrawl with
crawlablecrawledcrawlercrawley
crawlingcrawling back to youcrawling horrorcrawlspace
crawlycraxcraycraye
crayercrayer, caspar decrayettecrayfish
crayfishercrayfishermancrayfisherycrayola
crayoncrayonedcrayoningcrayonlike
craythurcrayturcrazecraze-mill
crazedcrazedlycrazednesscrazily
crazinesscrazingcrazing-millcrazy
crazy bitchcrazy bonecrazy eightscrazy eyes
crazy gluecrazy golfcrazy horsecrazy house
crazy like a foxcrazy pavingcrazy quiltcrazy weed
crazy-asscrazyweedcrccrc handbook
crécreablecreacionismocreaght
creakcreakedcreakilycreakiness
creakingcreakinglycreakle, mr.creaky
creamcream cakecream cheesecream corn
cream crackercream crackeredcream in ones jeanscream laid
cream of tartarcream of the cropcream of wheatcream off
cream piecream pitchercream puffcream sauce
cream sodacream teacream upcream violet
cream-coloredcream-colored cours…cream-facedcream-fruit
cream-of-tartar treecream-slicecream-whitecreamcake
creamcupscreamedcreamed corncreamer
creameriescreamerycreamilycreaminess
creamingcreamlesscreamlikecreampie
creamsiclecreamwarecreamycreance
creantcreasecrease-resistantcreased
creaselesscreaseproofcreasercreaseyite
creashakcreasingcreasotecreasy
creasy, sir edwardcreatcreatablecreate
create (dc)create by mental actcreate from raw mat…create from raw stu…
create mentallycreate verballycreate, read, updat…created
created bycreatescreaticcreatin
creatinecreatine kinasecreatine kinase, bb…creatine kinase, mb…
creatine kinase, mi…creatine kinase, mm…creatine phosphatecreatine phosphoric…
creatingcreating by mental …creating by removalcreating from raw m…
creating one fleshcreatinincreatininasecreatinine
creationcreation sciencecreationalcreationarily
creationarycreationismcreationistcreationistic
creativasc medicalcreativecreative accountingcreative activity
creative alliescreative artists ag…creative brain stud…creative circle adv…
creative citizencreative commonscreative commons li…creative destruction
creative differencescreative energycreative personcreative skillset
creative thinkercreative thinkingcreative workcreative writing
creativelivecreativelycreativenesscreativity
creatorcreatorlesscreatorlikecreators
creatorshipcreatresscreatrixcreatural
creaturecreature comfortcreature comfortscreature feature
creaturedomcreaturelesscreaturelikecreatureliness
creaturelycreaturescreatures of habitcreatureship
creaturizecreazecreb-binding proteincrébillon
crebricostatecrebrisulcatecrebritudecrebrous
crechecrécycredcredal
credant technologiescredencecredence tablecredenda
credendumcredentcredentialcredentialed
credentialingcredentialismcredentializationcredentials
credenzacrederitycredibilitycredibility gap
crediblecrediblenesscrediblycredit
credit accountcrédit agricole co…credit analystcredit application
credit bureaucredit cardcredit card fraudcredit card tart
credit crunchcredit default opti…credit default swapcredit entry
credit eventcrédit fonciercredit hourcredit limit
credit linecredit mobiliercredit notecredit order
credit ratingcredit referencecredit reportcredit risk
credit scorecredit score in the…credit sesamecredit side
credit systemcredit transfercredit unioncredit-deposit ratio
creditabilitycreditablecreditablenesscreditably
creditedcreditingcreditlesscrédito
creditorcreditor's rightscreditors rightscreditress
creditrixcreditscreditworthinesscreditworthy
credneritecredocredobaptistcredophile
credoraxcredulitivenesscredulitycredulous
credulouslycredulousnesscreecreech, william
creedcreedalcreeditecreedless
creedmorecreekcreek bedcreek confederacy
creekfishcreekfrontcreekologycreeks
creeksidecreekwatercreekycreel
creelercreemcreepcreep feed
creep increep intocreep jointcreep someone out
creep upcreep up oncreepagecreeper
creepethcreepholecreepiecreepify
creepilycreepinesscreepingcreeping barrage
creeping bellflowercreeping bentcreeping bentgrasscreeping bugle
creeping buttercupcreeping charliecreeping crowfootcreeping elegance
creeping featurismcreeping featuritiscreeping ferncreeping jenny
creeping junipercreeping lilycreeping minecreeping oxalis
creeping snowberrycreeping soft grasscreeping spike rushcreeping st john's …
creeping thistlecreeping thymecreeping willowcreeping windmill g…
creeping wintergreencreeping wood sorrelcreeping zinniacreepingly
creeplecreepmetercreepscreepy
creepy-crawliescreepy-crawlycreepy-peepycrees
creesecreftingcreighton, mandellcrema
cremaillerecremainscremastercremasteric
crematecremationcremation chambercremationist
crematorcrematorialcrematoriescrematorium
crematoriumscrematorycremecreme anglais
creme bruleecreme caramelcreme de cacaocreme de fraise
creme de menthecrème fraîchecrémieuxcremo, west virginia
cremocarpcremonacremorcremorne
cremosincremscremulatorcrenarchaeal
crenarchaeoncrenarchaeotacrenarchaeotalcrenarchaeote
crenatecrenate leafcrenatedcrenation
crenaturecrenelcrenelatecrenelated
crenelated moldingcrenelatingcrenelationcrenellate
crenellatedcrenellated mouldingcrenellationcrenelle
crenelledcrenglecrenic acidcrenkle
crenotherapycrenshawcrenulatecrenulated
crenulationcreocreodontcreole
creole statecreole-fishcreoleancreolian
creolincreolizationcreolizecreon
creopointcreosolcreosotecreosote bush
creosotedcreosotelikecreosotingcrep
crepancecrepanecrepecrepe de chine
crepe ferncrepe flowercrepe gardeniacrepe jasmine
crepe marocaincrepe myrtlecrepe papercrepe rubber
crepe suzettecrepelikecreperiecrepey
crepidomacrepiscrepitantcrepitate
crepitatedcrepitatingcrepitationcrepitation rale
crepitouscrepituscreponcrept
crepusclecrepuscularcrepuscular raycrepuscularity
crepuscularlycrepusculecrepusculinecrepusculous
crepusculumcreraritecrescencecrescendo
crescendo biosciencecrescentcrescent citycrescent moon
crescent rollcrescent unmanned s…crescent-cell anaem…crescent-cell anemia
crescent-shapedcrescentiacrescentia cujetecrescentic
crescentinicrescentiuscrescentwisecrescive
crescocrescographcresolcresolate
cresorcincrespellecrespi, giuseppecrespine
crespocresscress greencress plant
cressellecressescressetcressida
cresslikecressoncressycrest
crest cloudcrest syndromecrestatechcrested
crested cariamacrested coral rootcrested larkcrested myna
crested penguincrested screamercrested swiftcrested tit
crested wheat grasscrested wheatgrasscrestfallencrestie
crestingcrestlesscrestless wavecrestmont
crestone telecomcreswell, sir cresw…creswick, thomascresyl
cresyliccreta, oklahomacretaceancretaceous
cretaceous periodcretaceouslycretaciouscretan
cretan dittanycretecrete dittanycretian
creticcreticismcretincretinise
cretinismcretinizecretinoidcretinous
cretismcretonnecretorcretose
creusacreusecreusot, lecreutzer
creutzfeldt-jakob d…creutzfeldt-jakob s…creutzfeldt–jakob…creux
creuzercrevallecrevalle jackcrevant
crevassecrèvecœurcrevetcrevice
crevicedcreviscrewcrew chief
crew cutcrew membercrew neckcrew neckline
crew sockcrew-served weaponcrewcutcrewe
crewedcrewelcrewelworkcrewer
crewetcrewlesscrewmancrewmate
crewmembercrewneckcrewneckedcrex
crex crexcrfscri de coeurcri de coeur*
cri du chat syndromecri technologiescri-du-chat syndromecria
cribcrib boardcrib deathcrib mattress
crib notecrib sheetcrib-bitercrib-biting
cribbagecribbage boardcribbedcribber
cribbingcribblecribbledcribbling
cribellumcribercriblikecribrate
cribrationcribriformcribriform platecribrose
cribrouscriccricetidcricetidae
cricetinaecricetuluscricetuscricetus cricetus
crichtoncrichton, jamescrichtonitecricify
crickcricketcricket ballcricket bat
cricket equipmentcricket fieldcricket frogcricket ground
cricket matchcricket pitchcricket whitescricket-bat willow
cricketercricketingcricketlesscrickets
cricketycricoidcricoid cartilagecricondentherm
cricothyroidcricothyroidotomycriddleitecried
crieffcriercriescriest
crigancrigler-najjar synd…crigler–najjar sy…crikey
crilecrilloncrimcrimble
crimbocrimecrime against human…crime against nature
crime analysiscrime and punishmentcrime fictioncrime lord
crime of passioncrime preventioncrime ratecrime scene
crime statisticscrime syndicatecrime victimscrime wave
crime-riddencrimeacrimea-congo hemorr…crimean
crimean peninsulacrimean tatarcrimean warcrimebuster
crimebustingcrimefightercrimefightingcrimefree
crimefulcrimelesscrimelikecrimereports
crimeriddencrimescrimes against huma…crimethinc.
crimethinkcrimewarecrimewatch uscrimewave
crimidinecriminalcriminal activitycriminal congress
criminal contemptcriminal conversati…criminal courtcriminal intelligen…
criminal intentcriminal investigat…criminal lawcriminal negligence
criminal offencecriminal possessioncriminal procedurecriminal prosecution
criminal psychologi…criminal psychologycriminal recordcriminal suit
criminalisationcriminalisecriminalismcriminalist
criminalisticscriminalitycriminalizationcriminalize
criminallycriminalnesscriminaloidcriminals
criminatecriminatedcriminatingcrimination
criminativecriminatorycriminicriminogenically
criminol.criminologicalcriminologistcriminology
criminouscriminousnesscriminycrimosin
crimpcrimpagecrimpedcrimper
crimpingcrimplecrimpledcrimpling
crimpnesscrimpycrimsoncrimson clover
crimson glorycrimson hexagoncrimson informaticscrimsoned
crimsoningcrimsonlycrimsonnesscrinal
crinan canalcrinatedcrinatorycrincum
crincum-crancumcrinedcrinelcrinet
cringecringelingcringemakingcringer
cringeworthycringingcringinglycringingness
cringlecringycriniculturalcriniere
crinigerouscrinioncrinitalcrinite
crinitorycriniviruscrinklecrinkle root
crinkle-rootcrinkledcrinklerootcrinkliness
crinklingcrinklycrinkycrinoid
crinoidalcrinoideacrinoideancrinoline
crinolinedcrinosecrinositycrinum
crioboliumcriollocriollo peoplecriosphinx
crioulocripcripescripple
cripple creekcrippledcrippled insidecrippleness
cripplercripplewarecripplingcripplingly
cripplycripscriptcrisco
crisescrisiscrisis action plann…crisis center
crisis interventioncrisis managementcrisis negotiationcrisis-ridden
crispcrisp breadcrispatecrispated
crispationcrispaturecrispbreadcrisped
crispencrispercrisphead lettucecrispi, francesco
crispilycrispincrispin and crispin…crispiness
crispingcrisplycrispnesscrisps
crispuscrispycrispy gamercrispy!
criss-crosscriss-cross applesa…crissacrissal
crisscrosscrisscross heartcrisscross-rowcrisscrossed
crissumcristcristacristal
cristalinacristallocristallologycristate
cristinacristo redentorcristobalcristobal balenciaga
cristóbal carbinecristobal coloncristobalitecristoforo colombo
critcrit.critchfieldcriteria
criterialcriterioncriterionalcriterionless
criterionscriteriorcriteriumcrith
crithidiacrithidia fascicula…crithomancucrithomancy
critiascriticcriticalcritical acclaim
critical analysiscritical anglecritical appraisalcritical asset
critical asset listcritical capabilitycritical carecritical condition
critical control po…critical diagnosticscritical functioncritical illness
critical informationcritical infrastruc…critical inquirycritical intelligen…
critical itemcritical item listcritical joint duty…critical literacy
critical masscritical mediacritical micelle co…critical occupation…
critical opalescencecritical pathcritical path methodcritical pathways
critical periodcritical period (ps…critical pointcritical practice
critical rationalismcritical requirementcritical reviewcritical reynolds n…
critical sectioncritical speedcritical supplies a…critical sustainabi…
critical technologi…critical theorycritical thinkingcritical tide level
critical updatecritical vulnerabil…criticalitycriticality assessm…
criticallycritically acclaimedcriticalmetricscriticalness
criticastercriticisablecriticisecriticised
criticisercriticisingcriticismcriticisms of globa…
criticizablecriticizationcriticizecriticizer
criticizinglycriticocriticproofcritics
critiquecritique^itcrititechcriton
crittercritter sittercrittercismcritters
criuscrix labscrixivancrizzel
crizzlecrizzledcrk-associated subs…crlf
crm softwarecrna goracrngedcro
croûtecro-magnoncro-quettecroagh
croakcroakedcroakercroaking
croakycroatcroatiacroatian
croatian peasant pa…croatian sheepdogcroato-serbiancroa`tia and slavon…
croccrocacincrocanthemum canade…croce
croceincroceouscrocethiacrocethia alba
crocetincrochecrochetcrochet hook
crochet needlecrochet stitchcrochetedcrocheter
crochetingcrochetworkcrochucrociary
crocidolitecrocincrockcrock of gold
crock of shitcrock potcrock upcrocked
crockercrockerscrockerycrocket
crocketedcrocketingcrockettcrockett, samuel ru…
crockingcrockpotcrockycrocodile
crocodile birdcrocodile clipcrocodile rivercrocodile tear
crocodile tearscrocodilelikecrocodiliacrocodilian
crocodilian reptilecrocodilitycrocodiluscrocodoc
crocodyliacrocodylidaecrocodyliformcrocodylomorph
crocodyluscrocodylus niloticuscrocodylus porosuscrocoisite
crocoitecrocolitecroconatecroconazole
croconiccroconic acidcrocosecrocosmia
crocottacrocscrocuscrocus sativus
crocus technologycrocuslikecrocutacrocuta crocuta
croesuscroftcroftercrofting
croftlandcrohncrohn diseasecrohn's disease
crohns diseasecroirecroiscroisade
croisadocroisecroissantcroissante
croissantlikecrois\u00e9croix de guerrecroker
croker, john wilsoncroker, t. croftoncroll, jamescroly, george
cromacromagnoncromakalimcromar
cromartycromecrome, johncromlech
cromniomancycromoglicatecromoglicic acidcromoglycate
cromolyncromolyn sodiumcromornacromorne
cromptoncrompton urban dist…crompton, samuelcromulent
cromwellcromwell (oliver)cromwell, olivercromwell, richard
cromwell, thomascromwelliancronartiumcronartium ribicola
cronecronelcronelikecronenbergian
cronetcroniancroniescronk
cronocronotecronstadtcronstedtite
crontabcronuscronusitecrony
cronyismcronyisticcroo monkeycroodle
crookcrook and nannycrookackcrookback
crookbackedcrookbillcrookedcrooked-stemmed ast…
crookedlycrookednesscrookencrookery
crookescrookes radiometercrookes tubecrookes, william
crookesitecrookingcrookneckcrookneck squash
crookscrooncroonedcrooner
crooningcroonycropcrop circle
crop failurecrop outcrop residuecrop rotation
crop topcrop upcrop venturescrop-dusting
crop-earcrop-earedcrop-tailedcropbound
cropdustercropecropfulcropland
croplandscroplikecroppablecropped
croppercroppingcrops, agriculturalcropsick
cropupcroque-madamecroque-monsieurcroquembouche
croquetcroquet ballcroquet equipmentcroquet mallet
croquetacroquetedcroquetingcroquetlike
croquettecroquiscrorecrorepati
crosbycroscarmellosecrosiercrosiered
crosletcrosnecrospovidonecross
cross a bridge befo…cross batcross bitcross bun
cross channelcross checkcross circulationcross compiler
cross connectioncross countrycross cover versioncross crosslet
cross dressingcross examinationcross examinecross fell
cross firecross florycross haircross hairs
cross infectioncross junctioncross matchingcross merchandising
cross multiplycross of calvarycross of goldcross of lorraine
cross offcross one's eyescross one's fingerscross ones arms
cross ones fingerscross ones heartcross oneselfcross out
cross overcross pathscross patt\u00e9ecross peen hammer
cross pixel mediacross postcross productcross protection
cross purposecross purposescross questioncross reactions
cross referencecross roadscross seacross section
cross someones palmcross someones pathcross streetcross swords
cross tabcross tabulationcross talkcross tell
cross that bridge w…cross the aislecross the floorcross the line
cross the rubiconcross thwartcross vinecross wind
cross wirecross, mrs.cross, southerncross, victoria
cross-cross-actioncross-armedcross-banded
cross-bearercross-beddingcross-benchcross-bencher
cross-birthcross-bordercross-bredcross-breed
cross-breedingcross-browsercross-buncross-cap
cross-channelcross-checkcross-classificationcross-compatible
cross-connecting bo…cross-console emula…cross-contaminatecross-contamination
cross-correlationcross-countrycross-country jumpi…cross-country riding
cross-country skiingcross-cousincross-crossletcross-cultural
cross-cultural comp…cross-cuttingcross-dayscross-division
cross-dockingcross-dresscross-dressercross-dressing
cross-examinationcross-examinecross-examinedcross-examiner
cross-examiningcross-eyecross-eyedcross-fertile
cross-fertilisationcross-fertilisecross-fertilizationcross-fertilize
cross-filecross-firecross-fostercross-fostering
cross-garnetcross-grainedcross-indexcross-infection
cross-jack yardcross-lagcross-leaved heathcross-legged
cross-levelingcross-lightcross-linguisticcross-linguistically
cross-linkcross-linkagecross-linkedcross-linking reage…
cross-loading (pers…cross-magnetizing e…cross-modalcross-multiplication
cross-multiplycross-over blockcross-over studiescross-party
cross-patchcross-pawlcross-phrasingcross-platform
cross-plycross-pollinatecross-pollinatingcross-pollination
cross-primingcross-purposecross-questioncross-questioned
cross-questionercross-questioningcross-ratiocross-react
cross-reactioncross-reactivitycross-readingcross-refer
cross-referencecross-resistancecross-sectioncross-sectional
cross-sectional stu…cross-sellcross-sellingcross-sentential
cross-servicingcross-shapedcross-spalecross-spall
cross-springercross-staffcross-stitchcross-stitcher
cross-stonecross-tabcross-tailcross-targeting (nu…
cross-tiecross-tiningcross-tolerancecross-town
cross-traincross-trainingcross-treescross-validation
cross-vaultingcross-weekcrossbandcrossbanding
crossbarcrossbarredcrossbeakcrossbeam
crossbeam systemscrossbenchcrossbenchercrossbenches
crossbillcrossbitecrossbodycrossbones
crossborderscrossbowcrossbow technologi…crossbower
crossbowmancrossbracingcrossbredcrossbreed
crossbreedercrossbreedingcrossbuckcrosscheck
crosschxcrossclaimcrossclasscrosscorrelation
crosscoupledcrosscouplingcrosscourtcrosscurrent
crosscutcrosscut sawcrosscuttingcrosse
crosse, andrewcrossectionalcrossedcrossed eye
crossed fingerscrossed loop sensorcrossed outcrosser
crossettecrosseyedcrossfadecrossfader
crossfeedcrossfibercrossfieldcrossfire
crossfirst bankcrossfishcrossflowcrossgender
crossgradecrossgrainedcrossguardcrosshair
crosshairscrosshatchcrosshatchedcrosshatching
crossheadcrossheadingcrossingcrossing area
crossing automationcrossing guardcrossing numbercrossing over
crossing over, gene…crossing the linecrossing wirescrossings
crossjackcrossleggedcrossletcrosslicense
crosslightcrosslikecrosslinearcrosslinearly
crosslinguisticcrosslinkcrosslinkercrossload
crossloopcrosslotscrosslycrossmatch
crossmatchedcrossmetathesiscrossnathcrossnational
crossnesscrossopterygiancrossopterygiicrossover
crossover dribblecrossover health ma…crossover votecrossover voter
crosspatchcrosspiececrosspipecrossplay
crossplayercrosspointcrosspostcrossposter
crossraguelcrossrangecrossreactcrossreaction
crossreactivecrossrefcrossroadcrossroads
crossroads systemscrossrowcrossruffcrosstab
crosstalkcrosstiecrosstowncrosstree
crosstreescrosstxcrosswalkcrossway
crosswayscrossways, dorsetcrosswindcrosswise
crosswordcrossword (puzzle)crossword puzzlecrosswordlike
crossworld warrantycrosswortcrostatacrostini
crotalcrotalariacrotalaria sagitall…crotalaria spectabi…
crotalid venomscrotalidaecrotalinecrotalo
crotalumcrotaluscrotalus adamanteuscrotalus atrox
crotalus cerastescrotalus horridus a…crotalus horridus h…crotalus lepidus
crotalus mitchelliicrotalus scutulatuscrotalus tigriscrotalus viridis
crotamitoncrotanaldehydecrotaphioncrotaphite
crotaphiticcrotaphytuscrotchcrotch fruit
crotch haircrotch rocketcrotch, williamcrotched
crotchescrotchetcrotchet restcrotcheted
crotchetinesscrotchetycrotchlesscroton
croton bugcroton eluteriacroton oilcroton tiglium
crotonacrotonaldehydecrotonamidecrotonate
crotonatescrotonbugcrotonecrotonic
crotonic acidcrotonic acidscrotoninecrotonylene
crotophagacrotoxincrottalcrottle
crottlescrotylcrotylationcrotylboration
crouchcrouch downcrouchedcroucher
crouchingcroudcroukecroup
croupadecroupalcroupecrouper
croupiercroupier's rakecroupierecroupiness
croupouscroupycrousecroustade
croutcroutoncrouzon syndromecrow
crow blackbirdcrow corncrow garliccrow pheasant
crow pointcrow scarercrow stepcrow's feet
crow's footcrow's nestcrow's-feetcrow's-foot
crow's-nestcrow-baitcrow-quillcrow-silk
crow-troddencrowbaitcrowbarcrowbar hotel
crowberrycrowberry familycrowdcrowd art
crowd catchcrowd controlcrowd intocrowd out
crowd playcrowd sciencecrowd supplycrowd surfer
crowd surfingcrowd technologiescrowd togethercrowd up
crowd-poisoningcrowdboostercrowdcastcrowdcompass
crowdcomputing syst…crowdedcrowdengineeringcrowder
crowderscrowdfeedcrowdflikcrowdflower
crowdfundercrowdfundingcrowdgathercrowdhall
crowdiecrowdingcrowdlikecrowdly
crowdmedcrowdmobcrowdopticcrowdpleaser
crowdrisecrowdscrowdslingcrowdsource
crowdsourcedcrowdsourcingcrowdspringcrowdstar
crowdstrikecrowdtapcrowdtiltcrowdtwist
crowdvancecrowdycrowdzonecrowdzu
crowe, eyre evanscrowe, sir james ar…croweatercrowed
crowflowercrowfootcrowfoot familycrowfoot grass
crowingcrowkeepercrowleyancrowlike
crowncrown beardcrown biosciencecrown cactus
crown colonycrown compoundscrown courtcrown daisy
crown estatecrown ethercrown etherscrown fire
crown flowercrown gallcrown glasscrown grafting
crown greencrown green bowlscrown imperialcrown in town
crown jewelcrown jewelscrown landcrown lengthening
crown lenscrown mammalcrown moldingcrown monkey
crown of thornscrown officecrown pointcrown prince
crown princesscrown roastcrown sawcrown side
crown vetchcrown viccrown wardcrown wart
crown wheelcrown-beardcrown-imperialcrown-of-the-field
crown-postcrown-rump lengthcrown-sawcrownbeard
crowne, johncrownedcrowned cranecrowned head
crowned pigeoncrownedstcrownercrownet
crowningcrownlesscrownletcrownlike
crownpeakcrownpiececrownscrownwork
crowscrows feetcrows footcrows nest
crowstepcrowstonecrowthcrowther, samuel ad…
crowtoecroydoncroydon faceliftcroylstone
croyncroyscrozecroze iron
croziercrozieredcrpcrs reprocessing se…
crtcrt screencrtscru
crubeenscrucescruces, cubacrucial
crucialitycruciallycruciancrucian carp
cruciatecruciate sulcuscruciationcrucible
crucible steelcrucible, electriccrucifercruciferae
cruciferouscruciferous plantcruciferous vegetab…crucified
crucifiercrucifixcrucifix fishcrucifixes
crucifixioncrucifixionlikecrucifixlikecruciform
crucifycrucifyingcrucigerouscruciverbalism
cruciverbalistcruckcrudcruddiness
cruddlecruddycrudecrude oil
crude sapcrude-oilcrudelycruden, alexander
crudenesscruditéscruditiescrudity
crudlecrudoscrudwarecrudy
cruelcruel and unusual p…cruel plantcruella de vil
cruellycruelnesscruelscruelties
crueltycruentarencruentatecruentous
cruetcruet-standcruftcruft together
cruftscruftsmanshipcruftycruikshank
cruikshank, georgecruiscruisecruise control
cruise linecruise linercruise missilecruise ship
cruisedcruiselikecruisercruiserweight
cruisewearcruisewisecruisingcruising altitude
cruising levelcruisycruivecrull
crullercrumbcrumb cakecrumb down
crumbclothcrumbedcrumbercrumbily
crumbinesscrumbingcrumblablecrumble
crumbledcrumblercrumblesscrumblet
crumblikecrumblinesscrumblingcrumblingly
crumblingscrumblycrumbscrumbum
crumbycrumcakecrumenalcrumhorn
crummablecrummilycrumminesscrummock
crummycrumpcrumpetcrumpiness
crumplecrumple zonecrumpledcrumpledness
crumplercrumplingcrumplycrumpy
crunchcrunch numberscrunch timecrunchable
crunchedcrunchercrunchinesscrunching
crunchinglycrunchycrunchyrollcrunk
crunklecrunodalcrunodecruor
cruorincrupcruppercrura
cruralcrurophiliacrurotarsalcrus
crusadecrusadedcrusadercrusaderlike
crusaderscrusadescrusades, thecrusading
crusadocrusecruse, illinoiscruset
crushcrush hatcrush oncrush on you
crush outcrush partycrush roomcrush syndrome
crushablecrushblvdcrushedcrushed leather
crushed rockcrushed sugarcrusheecrusher
crusher gaugecrushingcrushinglycrushpath
crushproofcrusoe, robinsoncrustcrusta
crustaceacrustaceancrustacean larvaecrustaceological
crustaceologistcrustaceologycrustaceouscrustaceousness
crustalcrustal movementcrustal platecrustalogical
crustalogistcrustalogycrustatedcrustation
crustedcrustiecrustiescrustific
crustilycrustinesscrustingcrustless
crustlikecrustosecrustose thalluscrustquake
crustycrutcrutchcrutched
crutchescrutchlikecruthcrutter
cruxcrux australiscrux biomedicalcrux gammata
crux of the mattercrux simplexcruxescruyff turn
cruz recordscruzacruzadocruzados
cruzancruzeirocrwthcry
cry all the way to …cry blue murdercry downcry for
cry for helpcry havoccry in ones beercry like a baby
cry like a little g…cry me a rivercry offcry ones eyes out
cry outcry out againstcry out forcry someone a river
cry the bluescry unclecry uncle!cry wolf
cry-babycry-baby treecryaesthesiacryal
crybabycrybaby treecryercryesthesia
cryin'cryingcrying birdcrying call
crying shamecryo-cryo-electron micro…cryo-transmission
cryo-transmission e…cryoablationcryoactivationcryoanaesthesia
cryoanesthesiacryobenchcryobiologicalcryobiologist
cryobiologycryobiosiscryobioticcryobuffer
cryocardioplegiacryocauterycryochreptcryocondensation
cryoconitecryocooledcryocoolercryocooling
cryocrystallographycryodetectorcryoelectroncryoelectron micros…
cryoelectroncscryoelectroniccryoelectronicscryofixation
cryofixedcryofocuscryofocusingcryogen
cryogenesiscryogeniancryogeniccryogenic liquid
cryogenicallycryogenicscryogeninecryogeny
cryoglobulincryoglobulinemiacryoglobulinscryohydrate
cryohydriccryokinesiscryolathecryolite
cryolithionitecryoliticcryomagneticcryometer
cryometriccryometrycryomicrographcryomicroscopic
cryomicroscopycryomodulecryoniccryonics
cryopathycryopelagiccryophiliccryophobia
cryophoruscryophysicscryophytecryoplankton
cryoportcryoprecipitatecryopreservationcryopreserve
cryopreservedcryopreservingcryoprobecryoprotect
cryoprotectedcryoprotectioncryoprotective agen…cryopump
cryopyrincryopyrin-associate…cryoregimecryosampling
cryoscopecryoscopiccryoscopycryosection
cryosectionedcryosectioningcryosleepcryosolvent
cryospherecryosphericcryostasiscryostat
cryostaticcryosurgeoncryosurgerycryosurgical
cryosurgicallycryotechnologycryotemperaturecryotherapist
cryotherapycryotomographiccryotomographycryotrap
cryotrappingcryotroncryoturbationcryoultramicrotomy
cryovialcryovolcaniccryovolcanismcryovolcano
cryoxtract instrume…cryppiecrypsiscrypt
cryptacanthodescryptacanthodes mac…cryptalcryptanalysis
cryptanalystcryptanalyticcryptanalyticscryptand
cryptarithmcryptatecrypticcryptic coloration
cryptic crosswordcrypticalcrypticallycrypticity
cryptidcryptidinecryptlikecrypto
crypto-crypto-fascismcrypto-fascistcrypto-fascistic
crypto-revisionismcryptobiontcryptobiosiscryptobiotic
cryptobranchiatacryptobranchiatecryptobranchidaecryptobranchus
cryptobranchus alle…cryptocaryacryptocercidaecryptocercus
cryptochannelcryptochiralcryptochiralitycryptochrome
cryptochromescryptococcalcryptococcosiscryptococcus
cryptococcus gattiicryptococcus neofor…cryptocorynecryptocracy
cryptocrystallinecryptodepressioncryptoexoticcryptogam
cryptogamecryptogamiacryptogamiaecryptogamian
cryptogamiccryptogamistcryptogamouscryptogenic
cryptogenic organiz…cryptogenic speciescryptogramcryptogramma
cryptogramma acrost…cryptogramma crispacryptogrammataceaecryptogrammatic
cryptogrammaticallycryptogramscryptographcryptographal
cryptographercryptographiccryptographic infor…cryptographical
cryptographicallycryptographistcryptographycryptohalite
cryptolaliacryptolectcryptolepiscryptologic
cryptologicalcryptologistcryptologycryptomaria
cryptomaterialcryptomelanecryptomeriacryptomeria japonica
cryptomnesiacryptomodulecryptomonadcryptomorphic
cryptomorphismcryptoncryptonephridialcryptonym
cryptonymiccryptopartcryptophanecryptophone
cryptophthalmoscryptophyceaecryptophytacryptophyte
cryptopinecryptoporticuscryptoprocessingcryptoprocessor
cryptoproctacryptoprocta feroxcryptorchidcryptorchidism
cryptorchidycryptorchismcryptosporacryptosporidiidae
cryptosporidiosiscryptosporidiumcryptosporidium par…cryptosystem
cryptotermescryptotermes breviscryptotiscryptotis parva
cryptotomographycryptoxanthincryptozoologicalcryptozoologist
cryptozoologycrypturicrystalcrystal ball
crystal clearcrystal countercrystal detectorcrystal gazing
crystal healingcrystal iscrystal latticecrystal meth
crystal microphonecrystal momentumcrystal oscillatorcrystal pickup
crystal pleatcrystal radiocrystal rectifiercrystal set
crystal structurecrystal teacrystal twinningcrystal violet
crystal-clearcrystalgenomicscrystalisationcrystalise
crystalisedcrystalizecrystalizedcrystalliferous
crystallincrystallinecrystalline fructosecrystalline humour
crystalline lenscrystallinitycrystallinscrystallisation
crystallisecrystallisedcrystallitecrystallizability
crystallizablecrystallizationcrystallization, el…crystallize
crystallizedcrystallized fruitcrystallized gingercrystallizer
crystallizingcrystallo-crystalloclastcrystallogenesis
crystallogeniccrystallogenicalcrystallogenycrystallogeometrical
crystallographercrystallographiccrystallographicalcrystallographically
crystallographycrystallography, x-…crystalloidcrystallomancy
crystallometrycrystallophonecrystallurgycrystalluria
crystalplexcry_wolfcr\u00e8checr\u00e8me anglaise
cr\u00e8me br\u00fb…cr\u00e8me caramelcr\u00e8me de cacaocr\u00e8me de cassis
cr\u00e8me de la cr…cr\u00e8me de menthecr\u00e8me fra\u00e…cr\u00e9maill\u00e8…
cr\u00eape de chinecr\u00eape papercr\u00eape suzettecr\u00eapy

The Web's Largest Resource for

Definitions & Translations


A Member Of The STANDS4 Network