Found 3,163 definitions starting with CR:

crcrêpesuzettecrèchecrème
crèmedecacaocrèmedecassiscrèmedelacr&…crèmedementhe
crèmefra&ici…crèvecoeurcr.cr/che
crabcrab applecrab boilcrab burger
crab cactuscrab canoncrab cocktailcrab grass
crab legscrab louiscrab lousecrab mentality
crab nebulacrab rangooncrab spidercrab tree
crab-eatercrab-eating dogcrab-eating foxcrab-eating macaque
crab-eating opossumcrab-eating raccooncrab-eating sealcrab-plover
crab-yawscrabapplecrabapple jellycrabbe, george
crabbedcrabbedlycrabbednesscrabber
crabbilycrabbinesscrabbingcrabbish
crabbitcrabburgercrabbycrabby person
crabeatercrabeater sealcrabercrabfaced
crabgrasscrabletcrablikecrabmeat
crabronidcrabscrabsidlecrabstick
crabwisecrac!crachecracid
cracidaecrackcrack a bookcrack a crib
crack a fatcrack a smilecrack a smile... an…crack addict
crack babycrack cocainecrack downcrack down (on)
crack down oncrack ficcrack housecrack of dawn
crack of doomcrack oncrack ones fingerscrack onto
crack pipecrack rockcrack rootcrack seed
crack shotcrack throughcrack traincrack up
crack whorecrack willowcrack wisecrack-brained
crack-pipecrack-upcrackacrackable
crackbackcrackberrycrackbraincrackbrained
crackdowncrackedcracked tooth syndr…cracked wheat
cracked-wheat breadcrackednesscrackercracker bonbon
cracker boxcracker crumbscracker jackcracker jacks
cracker-barrelcrackerberrycrackerboxcrackerjack
crackerlesscrackerlikecrackerscrackhead
crackhousecrackingcracking upcrackle
crackle chinacrackle – the bes…crackleberrycrackled
cracklescracklewarecracklikecrackling
cracklinglycracklingscracklinscrackly
cracknelcrackowcrackpipecrackpot
crackpotterycrackproofcrackscracksman
cracksmencracktivismcracktrocrackup
crackwhorecrackycracky wagoncracovian
cracoviennecracowcracowescracticidae
cracticinaecracticuscradd signaling ada…cradgedness
cradlecradle capcradle catholiccradle mountain
cradle of civilizat…cradle robbercradle snatchercradle technologies
cradle-to-cradle de…cradle-to-gravecradleboardcradled
cradlelikecradlesongcradlingcraft
craft centrecraft faircraft unioncrafted
craftednesscraftercraftilycraftiness
craftlesscraftlikecrafts centrecraftsman
craftsmanlikecraftsmanlycraftsmanshipcraftsmaster
craftsmencraftspersoncraftspersonshipcraftswoman
craftswomanshipcraftsycraftworkcraftworker
craftycragcragfastcragged
craggednesscraggercraggilycragginess
craggycragscragsmancragsmen
craiccraiecraigcraig flounder
craig serani marshcraig ventnercraig, johncraig, sir thomas
craigenputtockcraigiecraigslistcraigslist inc.
craigslistercraigslistingcraikcraik, george little
craik, mrs.crailcraincraiova
craisincrakecrakeberrycraker
crakowcramcram downcram full
cram schoolcram sessioncram worldwidecram-full
crambecrambe maritimacrambe plantcrambe sponge
crambocrambucramdowncramer
cramer, johann bapt…cramlingtoncrammedcrammer
crammingcramoisiecramoisycramp
cramp ironcramp someones stylecrampbarkcramped
crampednesscrampetcrampfishcrampiness
crampingcrampitcramponcramponee
cramponscrampooncrampoonscramps
crampycramstercrancranach
cranach, lucascranachancranagecranapple
cranberriescranberrycranberry bushcranberry culture
cranberry heathcranberry juicecranberry morphemecranberry sauce
cranberry treecranberryingcranberrylikecrance
cranchcrandallitecranecrane fly
crane shotcrane's billcrane's-billcrane, ichabod
crane, waltercrane-drivercranedcranefly
cranelikecranescranesbillcrang
crangoncrangonidaecranhamcrania
cranialcranial cavitycranial fontanellescranial fossa, ante…
cranial fossa, midd…cranial fossa, post…cranial indexcranial irradiation
cranial nervecranial nerve disea…cranial nerve injur…cranial nerve neopl…
cranial nervescranial orbitcranial sinusescranial sutures
craniallycraniatacraniatecranidium
craniectomycraningcraniocaudalcraniocerebral trau…
cranioclasmcranioclastcraniodentalcraniofacial
craniofacial abnorm…craniofacial abnorm…craniofacial dysost…craniofacially
craniognomycraniologicalcraniologicallycraniologist
craniologycraniomandibularcraniomandibular di…craniometer
craniometriccraniometric pointcraniometricalcraniometry
craniopaguscraniopharyngiomacraniosacralcranioscopist
cranioscopycraniosophiccraniosynostosescraniosynostosis
craniotacraniotomycranite systemscranium
craniumscrankcrank anglecrank angle degree
crank callcrank handlecrank lettercrank out
crank sciencecrank upcrankbirdcrankcase
crankedcrankilycrankinesscrankle
cranknesscrankpincrankscrankset
crankshaftcrankycranmercranmer, thomas
cranniedcranniescrannockcrannog
crannogecrannycrannyingcranston
crantcrantaracrantscrap
crap artistcrap gamecrap on a stickcrap ones pants
crap outcrap shootingcrap upcrap-shooter
crapaudcrapaud, jeancrapaudinecrape
crape ferncrape jasminecrape myrtlecraped
crapefishcrapehangercrapelikecrapette
crapfacecrapfestcrapfloodcrapgame
craphatcrapheadcrapholecraphouse
crapingcraploadcrapmobilecrapnel
crapolacrappercrappiecrappily
crappinesscrappitycrapplecrapplet
crappocrappycrapscrapshoot
crapshootercrapstormcraptacularcraptastic
craptasticalcraptexcrapulacrapule
crapulencecrapulentcrapulentallcrapulous
crapulouslycrapulousnesscrapwarecrapy
craquelurecrarecrascrase
crashcrash and burncrash barriercrash box
crash cartcrash coursecrash cymbalcrash diet
crash divecrash gearboxcrash helmetcrash hot
crash landcrash landingcrash locator beaconcrash out
crash padcrash position indi…crash programcrash programme
crash rescue and fi…crash spacecrash testcrash test dummy
crash trolleycrash-divecrash-helmetcrash-land
crashablecrashawcrashaw, richardcrashdump
crashedcrashercrashingcrashingly
crashlesscrashlikecrashlyticscrashpad
crashproofcrashworthinesscrashworthycrashy
crasiscraspediacraspedotacraspedote
crasscrassamentcrassamentumcrassiment
crassitudecrasslycrassnesscrassostrea
crassulacrassula ovatacrassulaceaecrassulacean
crassuscrassus, lucius lic…crassus, marcus lic…crastination
cratcrataeguscrataegus aestivaliscrataegus apiifolia
crataegus biltmorea…crataegus calpodend…crataegus coccineacrataegus coccinea …
crataegus crus-gallicrataegus laevigatacrataegus marshalliicrataegus mollis
crataegus monogynacrataegus oxyacanthacrataegus oxycanthacrataegus pedicella…
crataegus tomentosacratchcratecrated
cratefulcrateloadcratercrater face
crater lakecrater lake nationa…crater moundcratered
crateriformcratering chargecraterlesscraterlet
craterlikecraterostigmacraterouscraters of the moon
cratescratevacratingcratinus
cratippuscratippus of athenscratolagniacratology
cratoncratoniccraturcratureless
cratyluscraugastor augusticraunchcraunched
craunchingcravatcravattedcrave
cravedcravencravenedcravenette
craveningcravenlycravennesscraver
cravingcravingnesscrawcrawdad
crawdaddycrawdaddy!crawfishcrawfish out
crawfordcrawford and balcar…crawford, marioncrawford, thomas
crawforditecrawkcrawlcrawl in
crawl spacecrawl withcrawlablecrawled
crawlercrawlerwaycrawleycrawling
crawling back to youcrawling horrorcrawlspacecrawly
craxcraycrayecrayer
crayer, caspar decrayettecrayfishcrayfisher
crayfishermancrayfisherycrayolacrayon
crayonedcrayoningcrayonlikecraythur
crayturcrazecraze-millcrazed
crazedlycrazednesscrazilycraziness
crazingcrazing-millcrazycrazy bitch
crazy bonecrazy eightscrazy eyescrazy glue
crazy golfcrazy horsecrazy housecrazy like a fox
crazy pavingcrazy quiltcrazy weedcrazy-ass
crazyweedcrccrc handbookcré
creablecreacionismocreaghtcreak
creakedcreakilycreakinesscreaking
creakinglycreakle, mr.creakycream
cream cakecream cheesecream corncream cracker
cream crackeredcream in ones jeanscream laidcream of tartar
cream of the cropcream of wheatcream offcream pie
cream pitchercream puffcream saucecream soda
cream teacream upcream violetcream-colored
cream-colored cours…cream-facedcream-fruitcream-of-tartar tree
cream-slicecream-whitecreamcakecreamcups
creamedcreamed corncreamercreameries
creamerycreamilycreaminesscreaming
creamlesscreamlikecreampiecreamsicle
creamwarecreamycreancecreant
creasecrease-resistantcreasedcreaseless
creaseproofcreasercreaseyitecreashak
creasingcreasotecreasycreasy, sir edward
creatcreatablecreatecreate (dc)
create by mental actcreate from raw mat…create from raw stu…create mentally
create verballycreate, read, updat…createdcreated by
createscreaticcreatincreatine
creatine kinasecreatine kinase, bb…creatine kinase, mb…creatine kinase, mi…
creatine kinase, mm…creatine phosphatecreatine phosphoric…creating
creating by mental …creating by removalcreating from raw m…creating one flesh
creatinincreatininasecreatininecreation
creation sciencecreationalcreationarilycreationary
creationismcreationistcreationisticcreativasc medical
creativecreative accountingcreative activitycreative allies
creative artists ag…creative brain stud…creative circle adv…creative citizen
creative commonscreative commons li…creative destructioncreative differences
creative energycreative personcreative skillsetcreative thinker
creative thinkingcreative workcreative writingcreativelive
creativelycreativenesscreativitycreator
creatorlesscreatorlikecreatorscreatorship
creatresscreatrixcreaturalcreature
creature comfortcreature comfortscreature featurecreaturedom
creaturelesscreaturelikecreaturelinesscreaturely
creaturescreatures of habitcreatureshipcreaturize
creazecrebcreb-binding proteincrébillon
crebricostatecrebrisulcatecrebritudecrebrous
crechecrécycredcredal
credant technologiescredencecredence tablecredenda
credendumcredentcredentialcredentialed
credentialingcredentialismcredentializationcredentials
credenzacrederitycredibilitycredibility gap
crediblecrediblenesscrediblycredit
credit accountcrédit agricole co…credit analystcredit application
credit bureaucredit cardcredit card fraudcredit card tart
credit crunchcredit default opti…credit default swapcredit entry
credit eventcrédit fonciercredit historycredit hour
credit limitcredit linecredit mobiliercredit note
credit ordercredit ratingcredit referencecredit report
credit riskcredit scorecredit score in the…credit sesame
credit sidecredit systemcredit transfercredit union
credit-deposit ratiocreditabilitycreditablecreditableness
creditablycreditedcreditingcreditless
créditocreditorcreditor's rightscreditors rights
creditresscreditrixcreditscreditworthiness
creditworthycredneritecredocredobaptist
credophilecredoraxcredulitivenesscredulity
credulouscredulouslycredulousnesscree
creech, kentuckycreech, williamcreedcreedal
creeditecreedlesscreedmorecreeds
creekcreek bedcreek confederacycreekfish
creekfrontcreekologycreekscreekside
creekwatercreekycreelcreeler
creemcreepcreep feedcreep in
creep intocreep jointcreep someone outcreep up
creep up oncreepagecreepercreepeth
creepholecreepiecreepifycreepily
creepinesscreepingcreeping barragecreeping bellflower
creeping bentcreeping bentgrasscreeping buglecreeping buttercup
creeping charliecreeping crowfootcreeping elegancecreeping featurism
creeping featuritiscreeping ferncreeping jennycreeping juniper
creeping lilycreeping minecreeping oxaliscreeping snowberry
creeping soft grasscreeping spike rushcreeping st john's …creeping thistle
creeping thymecreeping willowcreeping windmill g…creeping wintergreen
creeping wood sorrelcreeping zinniacreepinglycreeple
creepmetercreepscreepycreepy-crawlies
creepy-crawlycreepy-peepycreescreese
creftingcreighton, mandellcremacremaillere
cremainscremastercremastericcremate
cremationcremation chambercremationistcremator
crematorialcrematoriescrematoriumcrematoriums
crematorycremecreme anglaiscreme brulee
creme caramelcreme de cacaocreme de fraisecreme de menthe
crème fraîchecrémieuxcremo, west virginiacremocarp
cremonacremorcremornecremosin
cremscremulatorcrenarchaealcrenarchaeon
crenarchaeotacrenarchaeotalcrenarchaeotecrenate
crenate leafcrenatedcrenationcrenature
crenelcrenelatecrenelatedcrenelated molding
crenelatingcrenelationcrenellatecrenellated
crenellated mouldingcrenellationcrenellecrenelled
crenglecrenic acidcrenklecrenotherapy
crenshawcrenulatecrenulatedcrenulation
creocreodontcreolecreole state
creole-fishcreoleancreoliancreolin
creolizationcreolizecreoncreopoint
creosolcreosotecreosote bushcreosoted
creosotelikecreosotingcrepcrepance
crepanecrepecrepe de chinecrepe fern
crepe flowercrepe gardeniacrepe jasminecrepe marocain
crepe myrtlecrepe papercrepe rubbercrepe suzette
crepelikecreperiecrepeycrepidoma
crepiscrepitantcrepitatecrepitated
crepitatingcrepitationcrepitation ralecrepitous
crepituscreponcreptcrepuscle
crepuscularcrepuscular raycrepuscularitycrepuscularly
crepusculecrepusculinecrepusculouscrepusculum
crépy, aisnecreraritecrescrescence
crescendocrescendo biosciencecrescentcrescent city
crescent mooncrescent rollcrescent unmanned s…crescent-cell anaem…
crescent-cell anemiacrescent-shapedcrescentiacrescentia cujete
crescenticcrescentinicrescentiuscrescentwise
crescivecrescocrescographcresol
cresolatecresorcincrespellecrespi, giuseppe
crespinecrespocresscress green
cress plantcressellecressescresset
cressidacresslikecressoncressy
crestcrest cloudcrest syndromecrestatech
crestedcrested cariamacrested coral rootcrested lark
crested mynacrested penguincrested screamercrested swift
crested titcrested wheat grasscrested wheatgrasscrestfallen
crestiecrestingcrestlesscrestless wave
crestmontcrestone telecomcreswellcreswell, sir cresw…
creswick, thomascresylcresyliccreta, oklahoma
cretaceancretaceouscretaceous periodcretaceously
cretaciouscretancretan dittanycrete
crete dittanycretiancreticcreticism
cretincretinisecretinismcretinize
cretinoidcretinouscretismcretonne
cretorcretosecreusacreuse
creusot, lecreutzercreutzfeldt-jakob d…creutzfeldt-jakob s…
creutzfeldt–jakob…creuxcreuzercrevalle
crevalle jackcrevantcrevassecrèvecœur
crevetcrevicecrevice corrosioncreviced
creviscrewcrew chiefcrew cut
crew membercrew neckcrew necklinecrew sock
crew-served weaponcrewcutcrewecrewed
crewelcrewelworkcrewercrewet
crewlesscrewmancrewmatecrewmember
crewneckcrewneckedcrexcrex crex
crfscrgcri de coeurcri de coeur*
cri du chat syndromecri technologiescri-du-chat syndromecria
cribcrib boardcrib deathcrib mattress
crib notecrib sheetcrib-bitercrib-biting
cribbagecribbage boardcribbedcribber
cribbingcribblecribbledcribbling
cribellumcribercriblikecribrate
cribrationcribriformcribriform platecribrose
cribrouscriccricetidcricetidae
cricetinaecricetuluscricetuscricetus cricetus
crichtoncrichton, jamescrichtonitecricify
crickcricketcricket ballcricket bat
cricket equipmentcricket fieldcricket frogcricket ground
cricket matchcricket pitchcricket whitescricket-bat willow
cricketercricketingcricketlesscrickets
cricketycricoidcricoid cartilagecricondentherm
cricothyroidcricothyroidotomycriddleitecried
crieffcriercriescriest
crigancrigler-najjar synd…crigler–najjar sy…crikey
crilecrilloncrimcrimble
crimbocrimecrime against human…crime against nature
crime analysiscrime and punishmentcrime fictioncrime lord
crime of passioncrime preventioncrime ratecrime scene
crime statisticscrime syndicatecrime victimscrime wave
crime-riddencrimeacrimea-congo hemorr…crimean
crimean peninsulacrimean tatarcrimean warcrimebuster
crimebustingcrimefightercrimefightingcrimefree
crimefulcrimelesscrimelikecrimereports
crimeriddencrimescrimes against huma…crimethinc.
crimethinkcrimewarecrimewatch uscrimewave
crimidinecriminalcriminal activitycriminal citation
criminal congresscriminal contemptcriminal conversati…criminal court
criminal intelligen…criminal intentcriminal investigat…criminal justice
criminal lawcriminal negligencecriminal offencecriminal possession
criminal procedurecriminal prosecutioncriminal psychologi…criminal psychology
criminal recordcriminal suitcriminalisationcriminalise
criminalismcriminalistcriminalisticscriminality
criminalizationcriminalizecriminallycriminalness
criminaloidcriminalscriminatecriminated
criminatingcriminationcriminativecriminatory
criminicriminogenicallycriminol.criminological
criminologistcriminologycriminouscriminousness
criminycrimosincrimpcrimpage
crimpedcrimpercrimpingcrimple
crimpledcrimplingcrimpnesscrimpy
crimsoncrimson clovercrimson glorycrimson hexagon
crimson informaticscrimsonedcrimsoningcrimsonly
crimsonnesscrinalcrinan canalcrinated
crinatorycrincumcrincum-crancumcrined
crinelcrinetcringecringeling
cringemakingcringercringeworthycringing
cringinglycringingnesscringlecringy
criniculturalcrinierecrinigerouscrinion
crinitalcrinitecrinitorycrinivirus
crinklecrinkle rootcrinkle-rootcrinkled
crinklerootcrinklinesscrinklingcrinkly
crinkycrinoidcrinoidalcrinoidea
crinoideancrinolinecrinolinedcrinose
crinositycrinumcrioboliumcriollo
criollo peoplecriosphinxcrioulocrip
cripescripplecripple creekcrippled
crippled insidecripplenesscripplercrippleware
cripplingcripplinglycripplycrips
criptcriscocrisescrisis
crisis action plann…crisis centercrisis interventioncrisis management
crisis negotiationcrisis-riddencrispcrisp bread
crispatecrispatedcrispationcrispature
crispbreadcrispedcrispencrisper
crisphead lettucecrispi, francescocrispilycrispin
crispin and crispin…crispinesscrispingcrisply
crispnesscrispscrispuscrispus attucks: a …
crispycrispy gamercrispy!criss cross
criss-crosscriss-cross applesa…crissacrissal
crisscrosscrisscross heartcrisscross-rowcrisscrossed
crissumcristcristacristal
cristalinacristallocristallologycristate
cristiano ronaldocristinacristo redentorcristobal
cristobal balenciagacristóbal carbinecristobal coloncristobalite
cristoforo colombocritcrit.critchfield
criteriacriterialcriterioncriterional
criterionlesscriterionscriteriorcriterium
crithcrithidiacrithidia fascicula…crithomancu
crithomancycritiascriticcritical
critical acclaimcritical analysiscritical anglecritical appraisal
critical assetcritical asset listcritical capabilitycritical care
critical conditioncritical control po…critical diagnosticscritical discourse …
critical enginecritical functioncritical illnesscritical information
critical infrastruc…critical infrastruc…critical inquirycritical intelligen…
critical itemcritical item listcritical joint duty…critical literacy
critical masscritical mediacritical micelle co…critical occupation…
critical opalescencecritical pathcritical path methodcritical pathways
critical periodcritical period (ps…critical pointcritical practice
critical rationalismcritical requirementcritical reviewcritical reynolds n…
critical sectioncritical speedcritical supplies a…critical sustainabi…
critical technologi…critical theorycritical thinkingcritical tide level
critical updatecritical valuecritical vulnerabil…criticality
criticality assessm…criticallycritically acclaimedcriticalmetrics
criticalnesscriticastercriticisablecriticise
criticisedcriticisercriticisingcriticism
criticisms of globa…criticizablecriticizationcriticize
criticizercriticizinglycriticocriticproof
criticscritiquecritique^itcrititech
critoncrittercritter sittercrittercism
critterscriuscrix labscrixivan
crizzelcrizzlecrizzledcrk-associated subs…
crlfcrm softwarecrna goracrnged
crocroûtecro-magnoncro-quette
croaghcroakcroakedcroaker
croakingcroakycroatcroatia
croatiancroatian peasant pa…croatian sheepdogcroato-serbian
croatscroa`tia and slavon…croccrocacin
crocanthemum canade…crocecroceincroceous
crocethiacrocethia albacrocetincroche
crochetcrochet hookcrochet needlecrochet stitch
crochetedcrochetercrochetingcrochetwork
crochucrociarycrocidolitecrocin
crockcrock of goldcrock of shitcrock pot
crock upcrockedcrockercrockers
crockerycrocketcrocketedcrocketing
crockettcrockett, samuel ru…crockingcrockpot
crockycrocodilecrocodile birdcrocodile clip
crocodile rivercrocodile tearcrocodile tearscrocodilelike
crocodilescrocodiliacrocodiliancrocodilian reptile
crocodilitycrocodiluscrocodoccrocodylia
crocodylidaecrocodyliformcrocodylomorphcrocodylus
crocodylus niloticuscrocodylus porosuscrocoisitecrocoite
crocolitecroconatecroconazolecroconic
croconic acidcrocosecrocosmiacrocotta
crocscrocuscrocus sativuscrocus technology
crocuslikecrocutacrocuta crocutacroesus
croftcroftercroftingcroftland
crohncrohn diseasecrohn's diseasecrohns disease
croirecroiscroisadecroisado
croisecroissantcroissantecroissantlike
crois\u00e9croix de guerrecrokercroker, john wilson
croker, t. croftoncroll, jamescroly, georgecrom
cromacromagnoncromakalimcromar
cromartycromecrome, johncromlech
cromniomancycromoglicatecromoglicic acidcromoglycate
cromolyncromolyn sodiumcromornacromorne
cromptoncrompton urban dist…crompton, samuelcromulent
cromwellcromwell (oliver)cromwell, olivercromwell, richard
cromwell, thomascromwelliancronartiumcronartium ribicola
cronecronelcronelikecronenbergian
cronetcroniancroniescronk
cronocronotecronstadtcronstedtite
crontabcronuscronusitecrony
cronyismcronyisticcroo monkeycroodle
crookcrook and nannycrookackcrookback
crookbackedcrookbillcrookedcrooked-stemmed ast…
crookedlycrookednesscrookencrookery
crookescrookes radiometercrookes tubecrookes, william
crookesitecrookingcrookneckcrookneck squash
crookscrooncroonedcrooner
crooningcroonycropcrop circle
crop failurecrop outcrop residuecrop rotation
crop topcrop upcrop venturescrop-dusting
crop-earcrop-earedcrop-tailedcropbound
cropdustercropecropfulcropland
croplandscroplikecroppablecropped
croppercroppingcrops, agriculturalcropsick
cropupcroque-madamecroque-monsieurcroquembouche
croquetcroquet ballcroquet equipmentcroquet mallet
croquetacroquetedcroquetingcroquetlike
croquettecroquiscrorecrorepati
crosbycroscarmellosecrosiercrosiered
crosletcrosnecrospovidonecross
cross a bridge befo…cross batcross bitcross bun
cross channelcross checkcross circulationcross compiler
cross connectioncross countrycross cover versioncross crosslet
cross dressingcross examinationcross examinecross fell
cross firecross florycross haircross hairs
cross infectioncross junctioncross matchingcross merchandising
cross multiplycross of calvarycross of goldcross of gold speech
cross of lorrainecross offcross one's eyescross one's fingers
cross ones armscross ones fingerscross ones heartcross oneself
cross outcross overcross pathscross patt\u00e9e
cross peen hammercross pixel mediacross postcross product
cross protectioncross purposecross purposescross question
cross reactionscross referencecross roadscross sea
cross sectioncross someones palmcross someones pathcross street
cross swordscross tabcross tabulationcross talk
cross tellcross that bridge w…cross the aislecross the floor
cross the linecross the rubiconcross thwartcross vine
cross windcross wirecross, mrs.cross, southern
cross, victoriacross-cross-actioncross-armed
cross-bandedcross-bearercross-beddingcross-bench
cross-benchercross-birthcross-bordercross-bred
cross-breedcross-breedingcross-browsercross-bun
cross-capcross-channelcross-checkcross-classification
cross-compatiblecross-connecting bo…cross-console emula…cross-contaminate
cross-contaminationcross-correlationcross-countrycross-country jumpi…
cross-country ridingcross-country skiingcross-cousincross-crosslet
cross-culturalcross-cultural comp…cross-cuttingcross-days
cross-divisioncross-dockingcross-dresscross-dresser
cross-dressingcross-examinationcross-examinecross-examined
cross-examinercross-examiningcross-eyecross-eyed
cross-fertilecross-fertilisationcross-fertilisecross-fertilization
cross-fertilizecross-filecross-firecross-foster
cross-fosteringcross-garnetcross-grainedcross-index
cross-infectioncross-jack yardcross-lagcross-leaved heath
cross-leggedcross-levelingcross-lightcross-linguistic
cross-linguisticallycross-linkcross-linkagecross-linked
cross-linking reage…cross-loading (pers…cross-magnetizing e…cross-modal
cross-multiplicationcross-multiplycross-over blockcross-over studies
cross-partycross-patchcross-pawlcross-phrasing
cross-platformcross-plycross-pollinatecross-pollinating
cross-pollinationcross-primingcross-purposecross-question
cross-questionedcross-questionercross-questioningcross-ratio
cross-reactcross-reactioncross-reactivitycross-reading
cross-refercross-referencecross-resistancecross-section
cross-sectionalcross-sectional stu…cross-sellcross-selling
cross-sententialcross-servicingcross-shapedcross-spale
cross-spallcross-springercross-staffcross-stitch
cross-stitchercross-stonecross-tabcross-tail
cross-targeting (nu…cross-tiecross-tiningcross-tolerance
cross-towncross-traincross-trainingcross-trees
cross-validationcross-vaultingcross-weekcrossband
crossbandingcrossbarcrossbarredcrossbeak
crossbeamcrossbeam systemscrossbenchcrossbencher
crossbenchescrossbillcrossbitecrossbody
crossbonescrossborderscrossbowcrossbow technologi…
crossbowercrossbowmancrossbracingcrossbred
crossbreedcrossbreedercrossbreedingcrossbuck
crosscheckcrosschxcrossclaimcrossclass
crosscorrelationcrosscoupledcrosscouplingcrosscourt
crosscurrentcrosscutcrosscut sawcrosscutting
crossecrosse, andrewcrossectionalcrossed
crossed eyecrossed fingerscrossed loop sensorcrossed out
crossercrossettecrosseyedcrossfade
crossfadercrossfeedcrossfibercrossfield
crossfirecrossfirst bankcrossfishcrossflow
crossgendercrossgradecrossgrainedcrossguard
crosshaircrosshairscrosshatchcrosshatched
crosshatchingcrossheadcrossheadingcrossing
crossing areacrossing automationcrossing guardcrossing number
crossing overcrossing over, gene…crossing the linecrossing wires
crossingscrossjackcrossleggedcrosslet
crosslicensecrosslightcrosslikecrosslinear
crosslinearlycrosslinguisticcrosslinkcrosslinker
crossloadcrossloopcrosslotscrossly
crossmatchcrossmatchedcrossmembercrossmetathesis
crossnathcrossnationalcrossnesscrossopterygian
crossopterygiicrossovercrossover dribblecrossover health ma…
crossover votecrossover votercrossoverscrosspatch
crosspiececrosspipecrossplaycrossplayer
crosspointcrosspostcrosspostercrossraguel
crossrangecrossreactcrossreactioncrossreactive
crossrefcrossroadcrossroadscrossroads systems
crossrowcrossruffcrosstabcrosstalk
crosstiecrosstowncrosstreecrosstrees
crosstxcrosswalkcrosswaycrossways
crossways, dorsetcrosswindcrosswisecrossword
crossword (puzzle)crossword puzzlecrosswordlikecrossworld warranty
crosswortcrostatacrostinicrotal
crotalariacrotalaria sagitall…crotalaria spectabi…crotalid venoms
crotalidaecrotalinecrotalocrotalum
crotaluscrotalus adamanteuscrotalus atroxcrotalus cerastes
crotalus horridus a…crotalus horridus h…crotalus lepiduscrotalus mitchellii
crotalus scutulatuscrotalus tigriscrotalus viridiscrotamiton
crotanaldehydecrotaphioncrotaphitecrotaphitic
crotaphytuscrotchcrotch fruitcrotch hair
crotch rocketcrotch, williamcrotchedcrotches
crotchetcrotchet restcrotchetedcrotchetiness
crotchetycrotchlesscrotoncroton bug
croton eluteriacroton oilcroton tigliumcrotona
crotonaldehydecrotonamidecrotonatecrotonates
crotonbugcrotonecrotoniccrotonic acid
crotonic acidscrotoninecrotonylenecrotophaga
crotoxincrottalcrottlecrottles
crotylcrotylationcrotylborationcrouch
crouch downcrouchedcrouchercrouching
croudcroukecroupcroupade
croupalcroupecroupercroupier
croupier's rakecroupierecroupinesscroupous
croupycrousecroustadecrout
croutoncrouzon syndromecrowcrow blackbird
crow corncrow garliccrow pheasantcrow point
crow scarercrow stepcrow's feetcrow's foot
crow's nestcrow's-feetcrow's-footcrow's-nest
crow-baitcrow-quillcrow-silkcrow-trodden
crowbaitcrowbarcrowbar hotelcrowberry
crowberry familycrowdcrowd artcrowd catch
crowd controlcrowd intocrowd outcrowd play
crowd sciencecrowd supplycrowd surfercrowd surfing
crowd technologiescrowd togethercrowd upcrowd-poisoning
crowdboostercrowdcastcrowdcompasscrowdcomputing syst…
crowdedcrowdengineeringcrowdercrowders
crowdfeedcrowdflikcrowdflowercrowdfunder
crowdfundingcrowdgathercrowdhallcrowdie
crowdingcrowdlikecrowdlycrowdmed
crowdmobcrowdopticcrowdpleasercrowdrise
crowdscrowdslingcrowdsourcecrowdsourced
crowdsourcingcrowdspringcrowdstarcrowdstrike
crowdtapcrowdtiltcrowdtwistcrowdvance
crowdycrowdzonecrowdzucrowe, eyre evans
crowe, sir james ar…croweatercrowedcrowflower
crowfootcrowfoot familycrowfoot grasscrowing
crowkeepercrowleycrowleyancrowlike
crowncrown attorneycrown beardcrown bioscience
crown cactuscrown colonycrown compoundscrown court
crown daisycrown estatecrown ethercrown ethers
crown firecrown flowercrown gallcrown glass
crown graftingcrown greencrown green bowlscrown imperial
crown in towncrown jewelcrown jewelscrown land
crown lengtheningcrown lenscrown mammalcrown molding
crown monkeycrown of thornscrown officecrown point
crown princecrown princesscrown roastcrown saw
crown sidecrown vetchcrown viccrown ward
crown wartcrown wheelcrown-beardcrown-imperial
crown-of-the-fieldcrown-postcrown-rump lengthcrown-saw
crownbeardcrowne, johncrownedcrowned crane
crowned headcrowned pigeoncrownedstcrowner
crownetcrowningcrownlesscrownlet
crownlikecrownpeakcrownpiececrowns
crownworkcrowscrows feetcrows foot
crows nestcrowstepcrowstonecrowth
crowther, samuel ad…crowtoecroycroydon
croydon faceliftcroylstonecroyncroys
crozecroze ironcroziercroziered
crpcrs reprocessing se…crtcrt screen
crtscrucrubeenscruces
cruces, cubacrucialcrucialitycrucially
cruciancrucian carpcruciatecruciate sulcus
cruciationcruciblecrucible steelcrucible, electric
crucifercruciferaecruciferouscruciferous plant
cruciferous vegetab…crucifiedcrucifiercrucifix
crucifix fishcrucifixescrucifixioncrucifixionlike
crucifixlikecruciformcrucifycrucifying
crucigerouscruciverbalismcruciverbalistcruck
crudcruddinesscruddlecruddy
crudecrude oilcrude sapcrude-oil
crudelycruden, alexandercrudenesscrudités
cruditiescruditycrudlecrudos
crudwarecrudycruelcruel and unusual p…
cruel plantcruella de vilcruellycruelness
cruelscrueltiescrueltycruentaren
cruentatecruentouscruetcruet-stand
cruftcruft togethercruftscruftsmanship
cruftycruikshankcruikshank, georgecruis
cruisecruise controlcruise linecruise liner
cruise missilecruise shipcruisedcruiselike
cruisercruiserweightcruisewearcruisewise
cruisingcruising altitudecruising levelcruisy
cruivecrullcrullercrum
crumbcrumb cakecrumb downcrumbcloth
crumbedcrumbercrumbilycrumbiness
crumbingcrumblablecrumblecrumbled
crumblercrumblesscrumbletcrumblike
crumblinesscrumblingcrumblinglycrumblings
crumblycrumbscrumbumcrumby
crumcakecrumenalcrumhorncrummable
crummilycrumminesscrummockcrummy
crumpcrumpetcrumpinesscrumple
crumple zonecrumpledcrumplednesscrumpler
crumplingcrumplycrumpycrunch
crunch numberscrunch timecrunchablecrunched
crunchercrunchinesscrunchingcrunchingly
crunchycrunchyrollcrunkcrunkle
crunodalcrunodecruorcruorin
crupcruppercruracrural
crurophiliacrurotarsalcruscrusade
crusadedcrusadercrusaderlikecrusaders
crusadescrusades, thecrusadingcrusado
crusecruse, illinoiscrusetcrush
crush hatcrush oncrush on youcrush out
crush partycrush roomcrush syndromecrushable
crushblvdcrushedcrushed leathercrushed rock
crushed sugarcrusheecrushercrusher gauge
crushingcrushinglycrushpathcrushproof
crusoe, robinsoncrustcrustacrustacea
crustaceancrustacean larvaecrustaceologicalcrustaceologist
crustaceologycrustaceouscrustaceousnesscrustal
crustal movementcrustal platecrustalogicalcrustalogist
crustalogycrustatedcrustationcrusted
crustiecrustiescrustificcrustily
crustinesscrustingcrustlesscrustlike
crustosecrustose thalluscrustquakecrusty
crutcrutchcrutchedcrutches
crutchlikecruthcruttercrux
crux australiscrux biomedicalcrux gammatacrux of the matter
crux simplexcruxescruyff turncruz records
cruzacruzadocruzadoscruzan
cruzeirocrwthcrycry all the way to …
cry blue murdercry downcry forcry for help
cry havoccry in ones beercry like a babycry like a little g…
cry me a rivercry offcry ones eyes outcry out
cry out againstcry out forcry someone a rivercry the blues
cry unclecry uncle!cry wolfcry-baby
cry-baby treecryaesthesiacryalcrybaby
crybaby treecryercryesthesiacryin'
cryingcrying birdcrying callcrying shame
cryo-cryo-electron micro…cryo-transmissioncryo-transmission e…
cryoablationcryoactivationcryoanaesthesiacryoanesthesia
cryobenchcryobiologicalcryobiologistcryobiology
cryobiosiscryobioticcryobuffercryocardioplegia
cryocauterycryochreptcryocondensationcryoconite
cryocooledcryocoolercryocoolingcryocrystallography
cryodetectorcryoelectroncryoelectron micros…cryoelectroncs
cryoelectroniccryoelectronicscryofixationcryofixed
cryofocuscryofocusingcryogencryogenesis
cryogeniancryogeniccryogenic liquidcryogenically
cryogenicscryogeninecryogenycryoglobulin
cryoglobulinemiacryoglobulinscryohydratecryohydric
cryokinesiscryolathecryolitecryolithionite
cryoliticcryomagneticcryometercryometric
cryometrycryomicrographcryomicroscopiccryomicroscopy
cryomodulecryoniccryonicscryopathy
cryopelagiccryophiliccryophobiacryophorus
cryophysicscryophytecryoplanktoncryoport
cryoprecipitatecryopreservationcryopreservecryopreserved
cryopreservingcryoprobecryoprotectcryoprotected
cryoprotectioncryoprotective agen…cryopumpcryopyrin
cryopyrin-associate…cryoregimecryosamplingcryoscope
cryoscopiccryoscopycryosectioncryosectioned
cryosectioningcryosleepcryosolventcryosphere
cryosphericcryostasiscryostatcryostatic
cryosurgeoncryosurgerycryosurgicalcryosurgically
cryotechnologycryotemperaturecryotherapistcryotherapy
cryotomographiccryotomographycryotrapcryotrapping
cryotroncryoturbationcryoultramicrotomycryovial
cryovolcaniccryovolcanismcryovolcanocryoxtract instrume…
cryppiecrypsiscryptcryptacanthodes
cryptacanthodes mac…cryptalcryptanalysiscryptanalyst
cryptanalyticcryptanalyticscryptandcryptarithm
cryptatecrypticcryptic colorationcryptic crossword
crypticalcrypticallycrypticitycryptid
cryptidinecryptlikecryptocrypto-
crypto-fascismcrypto-fascistcrypto-fascisticcrypto-revisionism
cryptobiontcryptobiosiscryptobioticcryptobranchiata
cryptobranchiatecryptobranchidaecryptobranchuscryptobranchus alle…
cryptocaryacryptocercidaecryptocercuscryptochannel
cryptochiralcryptochiralitycryptochromecryptochromes
cryptococcalcryptococcosiscryptococcuscryptococcus gattii
cryptococcus neofor…cryptocorynecryptocracycryptocrystalline
cryptodepressioncryptoexoticcryptogamcryptogame
cryptogamiacryptogamiaecryptogamiancryptogamic
cryptogamistcryptogamouscryptogeniccryptogenic organiz…
cryptogenic speciescryptogramcryptogrammacryptogramma acrost…
cryptogramma crispacryptogrammataceaecryptogrammaticcryptogrammatically
cryptogramscryptographcryptographalcryptographer
cryptographiccryptographic infor…cryptographicalcryptographically
cryptographistcryptographycryptohalitecryptolalia
cryptolectcryptolepiscryptologiccryptological
cryptologistcryptologycryptomariacryptomaterial
cryptomelanecryptomeriacryptomeria japonicacryptomnesia
cryptomodulecryptomonadcryptomorphiccryptomorphism
cryptoncryptonephridialcryptonymcryptonymic
cryptopartcryptophanecryptophonecryptophthalmos
cryptophyceaecryptophytacryptophytecryptopine
cryptoporticuscryptoprocessingcryptoprocessorcryptoprocta
cryptoprocta feroxcryptorchidcryptorchidismcryptorchidy
cryptorchismcryptosporacryptosporidiidaecryptosporidiosis
cryptosporidiumcryptosporidium par…cryptosystemcryptotermes
cryptotermes breviscryptotiscryptotis parvacryptotomography
cryptoxanthincryptozoologicalcryptozoologistcryptozoology
crypturicrystalcrystal ballcrystal clear
crystal countercrystal detectorcrystal gazingcrystal healing
crystal iscrystal latticecrystal methcrystal microphone
crystal momentumcrystal oscillatorcrystal pickupcrystal pleat
crystal radiocrystal rectifiercrystal setcrystal structure
crystal teacrystal twinningcrystal violetcrystal-clear
crystalgenomicscrystalisationcrystalisecrystalised
crystalizecrystalizedcrystalliferouscrystallin
crystallinecrystalline fructosecrystalline humourcrystalline lens
crystallinitycrystallinscrystallisationcrystallise
crystallisedcrystallitecrystallizabilitycrystallizable
crystallizationcrystallization, el…crystallizecrystallized
crystallized fruitcrystallized gingercrystallizercrystallizing
crystallo-crystalloclastcrystallogenesiscrystallogenic
crystallogenicalcrystallogenycrystallogeometricalcrystallographer
crystallographiccrystallographicalcrystallographicallycrystallography
crystallography, x-…crystalloidcrystallomancycrystallometry
crystallophonecrystallurgycrystalluriacrystalplex
cry_wolfcr\u00e8checr\u00e8me anglaisecr\u00e8me br\u00fb…
cr\u00e8me caramelcr\u00e8me de cacaocr\u00e8me de cassiscr\u00e8me de la cr…
cr\u00e8me de menthecr\u00e8me fra\u00e…cr\u00e9maill\u00e8…cr\u00eape de chine
cr\u00eape papercr\u00eape suzettecr\u00eapy 

The Web's Largest Resource for

Definitions & Translations


A Member Of The STANDS4 Network